DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and Rpgr

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:XP_038955861.1 Gene:Rpgr / 367733 RGDID:1560136 Length:1380 Species:Rattus norvegicus


Alignment Length:451 Identity:125/451 - (27%)
Similarity:201/451 - (44%) Gaps:89/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  2990 VWGLNDKEQLGGLKGSKVKVPTFSQTISRLRP--IHIAGGSKSLFIVSQD-GKVYACGEGTNGRL 3051
            ::|.|:..|||....|.:..||   .|..|:|  :.:|...::..:||.| |.|||.|....|:|
  Rat    96 MFGSNNWGQLGLGSKSAISKPT---CIKALKPEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQL 157

  Fly  3052 GLGVTHNVPLPHQLPVLR-QYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHGNRTTLDK 3115
            |||.|.:....||:.... ..::|:::  :|...:.|||.|||:|.||:..:|::|..|::.:..
  Rat   158 GLGDTDDRDTFHQIGFFTPSDIIKQLS--AGANTSAALTEDGKLFMWGDNSEGQIGLKNKSNVCI 220

  Fly  3116 PRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDN--TTQLKPKLVTALAGRR 3178
            |.  |....|.|..::||..|||.:::.|||||:|..|.|:||..:.  .....|:.|..:.. :
  Rat   221 PH--EVTVGKPISWISCGYYHSAFVTTDGELYTFGEPENGKLGLPNQLLINHRSPQRVLGIPD-K 282

  Fly  3179 VVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFS 3243
            |:|||||.  ..|:.|||. .|:::|.|.||:|                  |:|....|      
  Rat   283 VIQVACGG--GHTVVLTEK-VVYAFGLGQFGQL------------------GLGTFLFE------ 320

  Fly  3244 LALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGGLRGRRVIHVAVGALHCLAVTDAGQVYAWG 3308
                                       ..:|:.|..::.:::.|::.|..|...:||.|.:|.:|
  Rat   321 ---------------------------TSEPKIIDRIKDQKISHISCGENHTALMTDIGLMYTFG 358

  Fly  3309 DNDHGQQGSG-NTFVNK-KPALVIGLDAVFVNRVACGSSHSIAWGLPNASS-DEEKRGPV--PFS 3368
            |..||:.|.| ..|.|: .|.|........|..:|||..|.:.:..|...: ||.:...|  |:.
  Rat   359 DGRHGKLGLGMENFTNQFFPTLCSNFLKFTVQLIACGGCHMLVFATPRLGTIDETEFEEVYEPYM 423

  Fly  3369 ST-----RDPLGGSSLGIYEAETMQTLKQE-----------AKPLNQSSLSESLALETPAA 3413
            ||     .|...||||....:..::..::|           ..||..:|.|.|.:..:|::
  Rat   424 STGSLSINDLSPGSSLNRSLSARLRRRERERPSCSASMVGTLPPLEGTSASTSASYFSPSS 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 16/52 (31%)
RCC1 3091..3140 CDD:278826 18/48 (38%)
RCC1 3144..3194 CDD:278826 19/51 (37%)
RCC1 3197..3246 CDD:278826 9/48 (19%)
RCC1 3250..3298 CDD:278826 5/47 (11%)
RCC1 3302..3350 CDD:278826 17/49 (35%)
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
RpgrXP_038955861.1 ATS1 <78..368 CDD:227511 96/333 (29%)
RCC1 352..398 CDD:395335 16/45 (36%)
MDN1 <625..904 CDD:227596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.