Sequence 1: | NP_608388.2 | Gene: | HERC2 / 33035 | FlyBaseID: | FBgn0031107 | Length: | 4912 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038956885.1 | Gene: | Sergef / 365243 | RGDID: | 1563497 | Length: | 481 | Species: | Rattus norvegicus |
Alignment Length: | 333 | Identity: | 94/333 - (28%) |
---|---|---|---|
Similarity: | 143/333 - (42%) | Gaps: | 66/333 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 4096 AVTPDGKLFATGYGSGGRLGVGGSDSWAIPTLLGSLQHVFVKKVAVNS---GGKHCLALTTEGEV 4157
Fly 4158 YAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLG- 4221
Fly 4222 -HGDSEDQLRPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGC--- 4282
Fly 4283 --------KLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDHVRR--- 4336
Fly 4337 -PKKVAA--LQGKKIISIATGSLHCVA-------------C--------------SDSGEVYTWG 4371
Fly 4372 DNDEGQLG 4379 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HERC2 | NP_608388.2 | RCC1 | 638..683 | CDD:278826 | |
RCC1 | 687..737 | CDD:278826 | |||
RCC1 | 740..787 | CDD:278826 | |||
RCC1 | 790..841 | CDD:278826 | |||
RCC1_2 | 828..857 | CDD:290274 | |||
Cyt-b5 | 1290..1363 | CDD:278597 | |||
MIB_HERC2 | 1928..1987 | CDD:284184 | |||
UBA_HERC2 | 2515..2559 | CDD:270585 | |||
Cul7 | 2624..2699 | CDD:288381 | |||
APC10-HERC2 | 2762..2932 | CDD:176485 | |||
RCC1 | 3037..3088 | CDD:278826 | |||
RCC1 | 3091..3140 | CDD:278826 | |||
RCC1 | 3144..3194 | CDD:278826 | |||
RCC1 | 3197..3246 | CDD:278826 | |||
RCC1 | 3250..3298 | CDD:278826 | |||
RCC1 | 3302..3350 | CDD:278826 | |||
RCC1_2 | 4136..4166 | CDD:290274 | 8/32 (25%) | ||
RCC1 | 4154..4203 | CDD:278826 | 13/48 (27%) | ||
RCC1 | 4206..4257 | CDD:278826 | 15/52 (29%) | ||
RCC1 | 4260..4309 | CDD:278826 | 14/59 (24%) | ||
RCC1 | 4312..4360 | CDD:278826 | 13/53 (25%) | ||
RCC1 | 4364..4413 | CDD:278826 | 10/16 (63%) | ||
HECTc | 4509..4880 | CDD:238033 | |||
HECTc | 4553..4878 | CDD:214523 | |||
Sergef | XP_038956885.1 | ATS1 | 17..>325 | CDD:227511 | 90/324 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |