DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and Rcc1l

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_001101802.1 Gene:Rcc1l / 360796 RGDID:1307558 Length:461 Species:Rattus norvegicus


Alignment Length:469 Identity:128/469 - (27%)
Similarity:175/469 - (37%) Gaps:133/469 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  2970 STSHEEAAAAPEQDLPC------------TVMVWGLNDKEQLGGLKGSKVKVPTFSQTIS----- 3017
            |.|..|||.| |.|.|.            .|.|||.:....||        ||:|....|     
  Rat    29 SRSRREAAEA-EADAPVFQYVGERAARADRVFVWGFSFSGALG--------VPSFVVPSSGPGPR 84

  Fly  3018 -------RLRPIHIAGGSKSLFIVSQDGKV--YACGEG----------TNGRLGLGVTHN----- 3058
                   |::|:.        :.:..|.|:  .|||.|          .....|:|:..:     
  Rat    85 AGLRPRRRIQPVP--------YRLELDHKISSAACGYGFTLLSSKTKDVTKVWGMGLNKDSQLGF 141

  Fly  3059 ---------------VPLPHQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHG 3108
                           .|.|..||:.|....|.:.|..|..|:|.||....|||.|....|:.|  
  Rat   142 HRSRKDKTRGYEYVLEPSPVPLPLDRPQETKVLQVSCGRAHSLVLTDREGVFSMGNNAHGQCG-- 204

  Fly  3109 NRTTLDKPRLVEALRAKKIRD-------VACGSSHSAAISSQGELYTWGLGEYGRLGHGD-NTTQ 3165
             |..::.....|:.:..:::|       |.||..||..::.:||:|:.|.|..|:.|.|. |.|.
  Rat   205 -RKVVEDEVYSESHKVHRMQDFEGQVVQVVCGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITS 268

  Fly  3166 LKPKLVTALAGRRVVQVA----CGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIE 3226
            ...||...|||..|||||    |      .|||:.||.||.||:.::.:|   .|....|...:.
  Rat   269 TPSKLGGDLAGVTVVQVATYGDC------CLALSADGGVFGWGNSEYLQL---ASVTDSTQVNVP 324

  Fly  3227 R---LSGIG-VVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRK-----PQPIGGLR- 3281
            |   .||:| |.|:.||......|...|.|:.||   |..||.|.:.....     |..:.||. 
  Rat   325 RCLPFSGVGKVKQVACGGTGCAILNEEGHVFVWG---YGILGKGPNLSETALPEMIPPTLFGLTE 386

  Fly  3282 ---GRRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQGSGNTFVNKKPALVIGLDAVFVNR---- 3339
               ..:|..:..|..|..|:|:.|:::.||.|..|..|.|..           .|..|..|    
  Rat   387 FNPEVKVSQIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRL-----------EDQYFPWRVTMP 440

  Fly  3340 -----VACGSSHSI 3348
                 ||||..|.:
  Rat   441 GEPVDVACGVDHMV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 18/82 (22%)
RCC1 3091..3140 CDD:278826 14/55 (25%)
RCC1 3144..3194 CDD:278826 22/54 (41%)
RCC1 3197..3246 CDD:278826 17/52 (33%)
RCC1 3250..3298 CDD:278826 14/56 (25%)
RCC1 3302..3350 CDD:278826 15/56 (27%)
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
Rcc1lNP_001101802.1 RCC1 127..186 CDD:278826 12/58 (21%)
RCC1_2 173..202 CDD:290274 10/28 (36%)
RCC1 192..242 CDD:278826 14/52 (27%)
RCC1_2 229..258 CDD:290274 10/28 (36%)
RCC1 245..295 CDD:278826 22/55 (40%)
RCC1 298..348 CDD:278826 17/52 (33%)
RCC1_2 393..422 CDD:290274 9/28 (32%)
RCC1 409..452 CDD:278826 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.