DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and rcbtb1

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_956285.1 Gene:rcbtb1 / 336007 ZFINID:ZDB-GENE-030131-7951 Length:531 Species:Danio rerio


Alignment Length:362 Identity:114/362 - (31%)
Similarity:175/362 - (48%) Gaps:25/362 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  3008 KVPTF----SQTISRLRPIHIAGGSKSLFI-VSQDGKVYACGEGTNGRLGLGVTHNVPLPHQLPV 3067
            |.|.|    :|.:|.:|...|.|.|.:..| ::.|.:||..|...:..||.|.:.:...|.:|..
Zfish     6 KWPLFTLLSAQELSSIRQACIFGASANEAIYITHDDEVYVLGLNCSNCLGTGDSQSTIAPKKLDC 70

  Fly  3068 LRQYVVKKV--AVHSGGKHALALTLDGKVFSWGEGEDGKLGHGNRTTLDKPRLVEA-LRAKKIRD 3129
            |..   ||:  ..:..|.|.|.:|.||::::||.....:||:|.......|.||.. |:.|::.:
Zfish    71 LSG---KKLISLSYGSGPHVLLVTEDGELYAWGHNGYSQLGNGTTNQGVSPILVSTNLQGKRVTE 132

  Fly  3130 VACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLKPKLVT-ALAGRRVVQVACGSRDAQTLA 3193
            |:|||.||.|::.:||::.||....|::|.|....|..|:.|: .|..:.:|.:|||  ...::|
Zfish   133 VSCGSHHSLALTHEGEVFAWGYNNCGQVGSGSTANQPTPRKVSNCLQNKVIVNIACG--QTSSMA 195

  Fly  3194 LTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKG 3258
            :|::|.|:.||....|:||.|.:....||..:..|.|..|:||..|...|||||..|.::.||..
Zfish   196 VTDNGEVYGWGYNGNGQLGLGNNGNQLTPCRLIALQGFCVLQIASGYAHSLALTDEGLLYAWGAN 260

  Fly  3259 DYYRLGHGGDQHVRKPQPIGGLRGRRVIHVAVGALHCLAV-TDAGQVYAWGDNDHGQQGSGNTFV 3322
            .|.:||.|...:...|..:...:.|.|...|..:.|..|. |.:||||.||      |..|...|
Zfish   261 TYGQLGTGNKSNQLSPVQVMTEKERIVEIAACHSTHTSAAKTQSGQVYMWG------QCRGQAIV 319

  Fly  3323 NKKPALVIGLDAVFVNRVACGSSHSIAWGLPNASSDE 3359
            ..........|.||    ||.::.|:.|.:.:...|:
Zfish   320 LPHLTHFASTDDVF----ACFATPSVMWRMLSMEHDD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 15/52 (29%)
RCC1 3091..3140 CDD:278826 18/49 (37%)
RCC1 3144..3194 CDD:278826 15/50 (30%)
RCC1 3197..3246 CDD:278826 18/48 (38%)
RCC1 3250..3298 CDD:278826 12/47 (26%)
RCC1 3302..3350 CDD:278826 15/47 (32%)
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
rcbtb1NP_956285.1 RCC1 40..90 CDD:278826 15/52 (29%)
RCC1_2 77..106 CDD:290274 8/28 (29%)
RCC1 93..143 CDD:278826 18/49 (37%)
RCC1 146..196 CDD:278826 15/51 (29%)
RCC1 199..248 CDD:278826 18/48 (38%)
RCC1 251..299 CDD:278826 12/47 (26%)
BTB 360..464 CDD:279045
BTB 371..467 CDD:197585
SPOP_C_like 467..525 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.