| Sequence 1: | NP_608388.2 | Gene: | HERC2 / 33035 | FlyBaseID: | FBgn0031107 | Length: | 4912 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014131.1 | Gene: | Magix / 317379 | RGDID: | 1549729 | Length: | 326 | Species: | Rattus norvegicus |
| Alignment Length: | 363 | Identity: | 76/363 - (20%) |
|---|---|---|---|
| Similarity: | 108/363 - (29%) | Gaps: | 153/363 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3213 RG-GSEGSDTPHE---IERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRK 3273
Fly 3274 PQPIGGLRGRRVIHVAVGAL-HCLAVTDAGQVYAWGDNDHGQQGSGNTFVNKKPALVIGLDAVFV 3337
Fly 3338 NRVACGSSHSIAWGLPNAS---SDEEKRGPVPFSSTRD---------PL---------------- 3374
Fly 3375 -----------GGSSLGIYEAETMQTLK----------QEAKPLNQSSLSE-------------- 3404
Fly 3405 --SLALET------------------PAARQAALGHVLRAMSILQARQLIVAALTSHSKVNFKER 3449
Fly 3450 --GAVG----GEEDHL---IGGPIMGAPLQLAETIAQG 3478 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HERC2 | NP_608388.2 | RCC1 | 638..683 | CDD:278826 | |
| RCC1 | 687..737 | CDD:278826 | |||
| RCC1 | 740..787 | CDD:278826 | |||
| RCC1 | 790..841 | CDD:278826 | |||
| RCC1_2 | 828..857 | CDD:290274 | |||
| Cyt-b5 | 1290..1363 | CDD:278597 | |||
| MIB_HERC2 | 1928..1987 | CDD:284184 | |||
| UBA_HERC2 | 2515..2559 | CDD:270585 | |||
| Cul7 | 2624..2699 | CDD:288381 | |||
| APC10-HERC2 | 2762..2932 | CDD:176485 | |||
| RCC1 | 3037..3088 | CDD:278826 | |||
| RCC1 | 3091..3140 | CDD:278826 | |||
| RCC1 | 3144..3194 | CDD:278826 | |||
| RCC1 | 3197..3246 | CDD:278826 | 11/36 (31%) | ||
| RCC1 | 3250..3298 | CDD:278826 | 12/48 (25%) | ||
| RCC1 | 3302..3350 | CDD:278826 | 8/47 (17%) | ||
| RCC1_2 | 4136..4166 | CDD:290274 | |||
| RCC1 | 4154..4203 | CDD:278826 | |||
| RCC1 | 4206..4257 | CDD:278826 | |||
| RCC1 | 4260..4309 | CDD:278826 | |||
| RCC1 | 4312..4360 | CDD:278826 | |||
| RCC1 | 4364..4413 | CDD:278826 | |||
| HECTc | 4509..4880 | CDD:238033 | |||
| HECTc | 4553..4878 | CDD:214523 | |||
| Magix | NP_001014131.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | 6/15 (40%) | |
| PDZ_signaling | 127..209 | CDD:238492 | 13/81 (16%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..267 | 5/52 (10%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||