DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and NEK8

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_835464.1 Gene:NEK8 / 284086 HGNCID:13387 Length:692 Species:Homo sapiens


Alignment Length:385 Identity:106/385 - (27%)
Similarity:166/385 - (43%) Gaps:88/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  4049 STIYGWGHNHRGQLGGLEGSRIKTPTPCEALSLLRPVQLAGGEQSLFAVTPDGKLF---ATGYGS 4110
            |::|.||       ||| |:.::.|     :.....||:|.|......||..|:|.   |...|:
Human   312 SSVYAWG-------GGL-GTPLRLP-----MLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGA 363

  Fly  4111 GGRLGVGGSDSWAIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMS 4175
            |     |||   .:|..:...|..|:.                                      
Human   364 G-----GGS---LLPGAVEQPQPQFIS-------------------------------------- 382

  Fly  4176 YDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEALLGY 4240
                :.:|..:|:::..:|||...:|.:|..|.::|:|.|..|.||||...|..:|.:|||||||
Human   383 ----RFLEGQSGVTIKHVACGDFFTACLTDRGIIMTFGSGSNGCLGHGSLTDISQPTIVEALLGY 443

  Fly  4241 RAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQF 4305
            ..:.:|||:  :..|.::.:..:::||.||.|:||.|..:....|.::....|....:|.||...
Human   444 EMVQVACGA--SHVLALSTERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQEAQRVVCGIDS 506

  Fly  4306 SVALTKSGAVYTWGKGDFHRLGHGSVDHVRRPKK-----------------VAALQGKKIISIAT 4353
            |:.||..|.....|...|::||   :||:...::                 .|.|..:.::||..
Human   507 SMILTVPGQALACGSNRFNKLG---LDHLSLGEEPVPHQQVEEALSFTLLGSAPLDQEPLLSIDL 568

  Fly  4354 GSLHCVACSDSGEVYTWGDNDEGQLGDGTVTAIQRPRLVAALQGKHIVKVTCGSAHTLAL 4413
            |:.|..|.:.||:.||:|.|..||||..|....:.|..|..|:|..:..|.||.|.|:|:
Human   569 GTAHSAAVTASGDCYTFGSNQHGQLGTNTRRGSRAPCKVQGLEGIKMAMVACGDAFTVAI 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 0/29 (0%)
RCC1 4154..4203 CDD:278826 6/48 (13%)
RCC1 4206..4257 CDD:278826 22/50 (44%)
RCC1 4260..4309 CDD:278826 14/48 (29%)
RCC1 4312..4360 CDD:278826 13/64 (20%)
RCC1 4364..4413 CDD:278826 20/48 (42%)
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
NEK8NP_835464.1 STKc_Nek8 3..258 CDD:270859
RCC1 276..657 CDD:332518 106/385 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..301
RCC1 1 312..350 15/50 (30%)
RCC1 2 410..461 22/52 (42%)
RCC1 3 462..513 16/50 (32%)
RCC1 4 580..631 20/49 (41%)
RCC1 5 632..684
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.