DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and SERGEF

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_036271.1 Gene:SERGEF / 26297 HGNCID:17499 Length:458 Species:Homo sapiens


Alignment Length:436 Identity:127/436 - (29%)
Similarity:188/436 - (43%) Gaps:67/436 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  4048 ASTIYGWGHNHRGQLGGLEGSRIKTPTP----CEALSLLRPVQLAGGEQSLFAVTPDGKLFATGY 4108
            |:.::.||.|..||||......:..|..    |:..|:.|   :.||......||..|.||..|.
Human    14 AAALFAWGANSYGQLGLGHKEDVLLPQQLNDFCKPRSVRR---ITGGGGHSAVVTDGGDLFVCGL 75

  Fly  4109 GSGGRLGVGGSDSWAIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLG--HG 4171
            ...|:||:|.::.....|...||....:::||  .|....:.||..|:|.:.|....|:||  ||
Human    76 NKDGQLGLGHTEDIPYFTPCKSLFGCPIQQVA--CGWDFTIMLTENGQVLSCGSNSFGQLGVPHG 138

  Fly  4172 NRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYG---RLGHGDSEDQL---- 4229
            .|... .|:.:| |:...|..||.|..|:.|.||||.|..||.|...   ||..|.:....    
Human   139 PRRCV-VPQAIE-LHKEKVVCIAAGLRHAVAATASGIVFQWGTGLASCGRRLCPGQTLPLFFTAK 201

  Fly  4230 RPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIES--LA 4292
            .|..|..|...:|:.:..||..:.:|  ||...|:.||...:|:|....: ...:|.|||:  ..
Human   202 EPSRVTGLENSKAMCVLAGSDHSASL--TDAGEVYVWGSNKHGQLANEAA-FLPVPQKIEAHCFQ 263

  Fly  4293 GLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKI--------- 4348
            ...|..:..|....||.|::|.::|||:.|:.:||          :|:...:|.|:         
Human   264 NEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLG----------RKLETYEGWKLEKQDSFLPC 318

  Fly  4349 ---ISIATGSLHC------VACSD-------SGEVYTWGDNDEGQLGDGTVTAIQRPRLVAALQG 4397
               .:....|.||      |:|..       .|..|:||.|:.|..||||...:..|:.|.||..
Human   319 SRPPNSMPSSPHCLTGATEVSCGSEHNLAIIGGVCYSWGWNEHGMCGDGTEANVWAPKPVQALLS 383

  Fly  4398 KHIVKVTCGSAHTLALSTSQLSERLRPLPNPPLEYDLVRDLAPEAL 4443
            ...:.|.||:.|:|||  .||......:.:|.:.|     |:|:|:
Human   384 SSGLLVGCGAGHSLAL--CQLPAHPALVQDPKVTY-----LSPDAI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 8/29 (28%)
RCC1 4154..4203 CDD:278826 17/50 (34%)
RCC1 4206..4257 CDD:278826 16/57 (28%)
RCC1 4260..4309 CDD:278826 12/50 (24%)
RCC1 4312..4360 CDD:278826 13/65 (20%)
RCC1 4364..4413 CDD:278826 19/48 (40%)
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
SERGEFNP_036271.1 RCC1 1 15..67 15/54 (28%)
RCC1 23..64 CDD:278826 11/43 (26%)
RCC1 2 68..119 16/52 (31%)
RCC1 68..116 CDD:278826 14/49 (29%)
RCC1_2 103..132 CDD:290274 8/30 (27%)
RCC1 119..167 CDD:278826 17/49 (35%)
RCC1 3 120..171 19/52 (37%)
RCC1 4 172..230 16/59 (27%)
RCC1_2 219..243 CDD:290274 8/25 (32%)
RCC1 5 231..283 14/52 (27%)
RCC1 231..279 CDD:278826 11/48 (23%)
RCC1 6 284..351 15/76 (20%)
RCC1 284..348 CDD:278826 15/73 (21%)
RCC1 351..399 CDD:278826 19/47 (40%)
RCC1 7 352..402 20/51 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..458 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.