DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and WWTR1

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_001161750.1 Gene:WWTR1 / 25937 HGNCID:24042 Length:400 Species:Homo sapiens


Alignment Length:480 Identity:96/480 - (20%)
Similarity:150/480 - (31%) Gaps:130/480 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1277 PKGGPPPADPETHYVRRADMENLLLDGSRCIILAGYVCDLSGYNCESETLRSVLDSGLGKDLTAE 1341
            |...|||..|               .|.:.|.:             ::.|.:.|::.....:..:
Human     3 PASAPPPLPP---------------PGQQVIHV-------------TQDLDTDLEALFNSVMNPK 39

  Fly  1342 MSSQVHRTAMEHILEHHKLGKYMVQASTEEKSSAPGPSRLT----HFSSECALAQL-LGLVANLM 1401
            .||...:...|...:....|.:..|:||:.....||| ||.    |..|..:.|.| ||..|. .
Human    40 PSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGP-RLAGGAQHVRSHSSPASLQLGTGAG-A 102

  Fly  1402 CSGPALQPAELQCRQLDKSSLLSGGLQLLQPSNPFDEEKGEARSSHSCHSTAGNTPTELPPPLPM 1466
            ...||.|.|.|:.:..|.:..|        |..|..|....|.......:......|...|...|
Human   103 AGSPAQQHAHLRQQSYDVTDEL--------PLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAM 159

  Fly  1467 QQ-----QLAPGRGKSQLQLRADAFISGLAEARVSEPPVAAWLALTERYCK--AHNLMWHQEFAT 1524
            .|     .|.|....:.:..|:.|         ||:|.    |.:..::.:  |.:.:..|...|
Human   160 NQPLNHMNLHPAVSSTPVPQRSMA---------VSQPN----LVMNHQHQQQMAPSTLSQQNHPT 211

  Fly  1525 EHPVQELERLLSAVLIRHQYLGGLVLNALETEVPPPRQLGEIIRLVHQAKWSVVRTRQQLNRSY- 1588
            ::|...|..:.:|:..:.|....|.|..::.|       .|.||:..:   .::|....|.|.. 
Human   212 QNPPAGLMSMPNALTTQQQQQQKLRLQRIQME-------RERIRMRQE---ELMRQEAALCRQLP 266

  Fly  1589 --KEVCAPILERLRFLLYEVRPAISPQQRGLRRL---PILQRPPRFKMLVRRLLQELRSSRQ--- 1645
              .|..||:...:.      .|.::|..|.:...   |.|...|            ..|..|   
Human   267 MEAETLAPVQAAVN------PPTMTPDMRSITNNSSDPFLNGGP------------YHSREQSTD 313

  Fly  1646 ----------PAKPEDLLNASIQQEQEKKPQSMPKQELEEQEEEETLLRRLNERQIHGEGELD-- 1698
                      |..|||.|:              ...|::..|........:|.:|......||  
Human   314 SGLGLGCYSVPTTPEDFLS--------------NVDEMDTGENAGQTPMNINPQQTRFPDFLDCL 364

  Fly  1699 PALMQDIVDFALQDSC----DVETA 1719
            |....|:.....:|..    |||:|
Human   365 PGTNVDLGTLESEDLIPLFNDVESA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597 8/72 (11%)
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
WWTR1NP_001161750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..117 21/66 (32%)
WW 125..156 CDD:197736 5/30 (17%)
Required for interaction with PALS1. /evidence=ECO:0000269|PubMed:21145499 222..400 40/210 (19%)
PDZ-binding 394..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.