DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and Ube3a

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_001380595.1 Gene:Ube3a / 22215 MGIID:105098 Length:870 Species:Mus musculus


Alignment Length:456 Identity:111/456 - (24%)
Similarity:192/456 - (42%) Gaps:91/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  4453 FSELVCPCLAMLPISGDLSLGALKDVLVYNIKEAAFRKVIQTTMVRDKQHGPVIELNRIQVKRSR 4517
            ||.:.||.: :..::.:|.|.....:.:|:.:    |..:..::|:.:|..|.:   |::|:|..
Mouse   470 FSFMTCPFI-LNAVTKNLGLYYDNRIRMYSER----RITVLYSLVQGQQLNPYL---RLKVRRDH 526

  Fly  4518 NRCNGLAGIDGMKSVFGQMVQKLPLLTQEALALPHRVWKVKFVGESVDDCGGGYSESIAEMCDEL 4582
                          :....:.:|.::..|..|...:...|:|.||...|.||...|....:.:|:
Mouse   527 --------------IIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEI 577

  Fly  4583 QNGSVPLLINTPNGRGEAGANRDCFLLDPTLSSVLQMNMFRFLGVLMGIAVRTGSPLSINLAEPV 4647
            .|..:.:..     ..||   ...|..:|  ||......|..:|:::|:|:.....|.::....|
Mouse   578 FNPDIGMFT-----YDEA---TKLFWFNP--SSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVV 632

  Fly  4648 WRQLTGEVLRPTDLTEVDRDYVAGLLCIRNMDDDPKLFTALE--------------LPFSTSSA- 4697
            :|:|.|:.....||.                |..|.|:.:|:              :.|..|.. 
Mouse   633 YRKLMGKKGTFRDLG----------------DSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTD 681

  Fly  4698 ------------RGHEVPLSTRYTHISPRNRAEYVRLALGFRLHE-FDEQVKAVRDGMSKVI-PV 4748
                        .|.::|       |:..||.|:|.|...:.|:: .::|.||.|.|...|. ..
Mouse   682 LFGNPMMYDLKENGDKIP-------ITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNES 739

  Fly  4749 PLLSLFSAAELQAMVCGSPDIPLGLLKSVATYK-GFDPSSALVTWFWEVMEEFTNQERSLFLRFV 4812
            ||..||...|::.::|||.::....|:....|. |:...|.::..|||::..||::::.|||:|.
Mouse   740 PLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFT 804

  Fly  4813 WGRTRLPRTIADFRGRDFVLQVLEKNPPD-HFLPESYTCFFLLKMPRYSCKAVLLEKLKYAIHFC 4876
            .|..|.|     ..|...:..::.||.|| ..||.|:|||.:|.:|.||.|..|.|:|..||.:.
Mouse   805 TGTDRAP-----VGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA 864

  Fly  4877 K 4877
            |
Mouse   865 K 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033 100/400 (25%)
HECTc 4553..4878 CDD:214523 94/356 (26%)
Ube3aNP_001380595.1 AZUL 27..81 CDD:406862
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..223
HECTc 518..868 CDD:238033 100/403 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.