DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and W09G3.7

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_001021671.2 Gene:W09G3.7 / 173245 WormBaseID:WBGene00012370 Length:404 Species:Caenorhabditis elegans


Alignment Length:403 Identity:99/403 - (24%)
Similarity:168/403 - (41%) Gaps:46/403 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  2976 AAAAPEQDLPCTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLR-PIHIA-GGSKSLFIVSQDG 3038
            :|....:::.|.|...||:..   |.|...|:...:...|....| |..|| ..:||:..:| .|
 Worm    14 SAGKTRKNVDCAVYGCGLSAS---GALAIPKLVANSDDVTAGEARFPKRIAYFNTKSIKFIS-SG 74

  Fly  3039 KVYACGEGTNGRLGLGVTHNVPLPHQLPVLRQY-----VVKKV--------AVHSGGKHALALTL 3090
            ..::.....|...|.|:.:...:..||..:.:|     ..||:        .:.||..|:|..|.
 Worm    75 FGFSLFASKNRLYGAGINNRFQIGGQLTNINKYQDYYISAKKINIPGDEILEISSGRAHSLIRTN 139

  Fly  3091 DGKVFSWGEGEDGKLGHGNRTTLD-------KPRL-VEALRAKKIRDVACGSSHSAAISSQGELY 3147
            .| ||:.|:...|:.|. |...:|       .|.| :....::.|..:.|....|..:.|.|.::
 Worm   140 LG-VFAIGDNNFGQCGR-NPENMDYVVGSEESPLLPLSFPTSEPIISIHCSMDTSFVVDSSGAVF 202

  Fly  3148 TWGLGEYGRLGHGDNTTQLKPKLVTALAGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLG 3212
            ::||.|.|:.|:.....|.:|..|........:|...||.|. .||.:|:|.:|.||..::|:..
 Worm   203 SFGLNEDGQCGNEAYGIQWEPAKVRGDVEGSKIQKVSGSTDT-LLACSENGEIFIWGQTEYGQAA 266

  Fly  3213 RGGSE-GSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGD-QHVRKP- 3274
            ....| ..:|...:....| .::.::......:|....|.|:.||.|   .||.|.: :.::.| 
 Worm   267 GATDEIQLNTSRHVANSLG-PIICVDSTQSSVVARNSRGNVFVWGVG---VLGMGPEAESLKTPT 327

  Fly  3275 ---QPIGGLRGRRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQGSGNTFVNKKP-ALVIGLDAV 3335
               ||:  ..|:.|..|:.|.....|:.:.|:::.||:|.:...|.|:......| .|.:..|  
 Worm   328 QMDQPL--FDGKMVTSVSAGNSCMSAINEDGRLFIWGENRYSSLGLGHQKRQLFPYQLFLPGD-- 388

  Fly  3336 FVNRVACGSSHSI 3348
             |.:.|.|..||:
 Worm   389 -VRKAALGPDHSL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 13/63 (21%)
RCC1 3091..3140 CDD:278826 13/56 (23%)
RCC1 3144..3194 CDD:278826 14/49 (29%)
RCC1 3197..3246 CDD:278826 8/49 (16%)
RCC1 3250..3298 CDD:278826 15/52 (29%)
RCC1 3302..3350 CDD:278826 14/48 (29%)
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
W09G3.7NP_001021671.2 ATS1 <108..347 CDD:227511 61/247 (25%)
RCC1 142..195 CDD:278826 12/53 (23%)
RCC1 198..239 CDD:278826 10/40 (25%)
RCC1 355..402 CDD:278826 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.