DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and wwp-1

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_740775.1 Gene:wwp-1 / 171647 WormBaseID:WBGene00007009 Length:794 Species:Caenorhabditis elegans


Alignment Length:439 Identity:105/439 - (23%)
Similarity:190/439 - (43%) Gaps:58/439 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  4472 LGALKDVLVYNIKEAAFR-KVIQTTMVRDKQHGPVIELNRIQVKRSRNRCNGLAGIDGMKSVFGQ 4535
            :|.|..|.|....|.:|| |:.|...:......|    |.:::..|||            :||..
 Worm   403 VGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVP----NHVKITVSRN------------NVFED 451

  Fly  4536 MVQKLPLLTQEALALPHRVWKVKFVGESVDDCGGGYSESIAEMCDELQNGSVPLLINTPNGRGEA 4600
            ..|:  ::.:.|:.|..|:: ::|.||...|.||...|....:..|:.|....|.:...|.....
 Worm   452 SFQE--IMRKNAVDLRRRLY-IQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSL 513

  Fly  4601 GANRDCFLLDPTLSSVLQMNMFRFLGVLMGIAVRTGSPLSINLAEPVWRQLTGEVLRPTDLTEVD 4665
            ..|...| ::|.     .:..|.::|..:.:|:..|..:......|.::::..:.:...|:.:||
 Worm   514 QINPASF-VNPD-----HLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVD 572

  Fly  4666 RDYVAGLLCIR--NMDD-DPKLFTALELPFSTSSARGHEVPLSTRYTHISPRNRAEYVRLALGFR 4727
            .:....|:.|:  |:|: |.:|:...:... ....:.:|:........::..|:.||:.|.:.:|
 Worm   573 SEIYNSLMWIKDNNIDECDMELYFVADYEL-LGELKTYELKEGGTEIAVTEENKLEYIELLVEWR 636

  Fly  4728 LHE-FDEQVKAVRDGMSKVIPVPLLSLFSAAELQAMVCGSPDIPLGLLKSVATYKGFDPSSALVT 4791
            .:. .::|.||...|.:.|.|:..:..|...||:.::||..|:.:...:....|:.:.|.|..||
 Worm   637 FNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVT 701

  Fly  4792 WFWEVMEEFTNQERSLFLRFVWGRTRLPRTIADF------RGRDFVLQVLEKNPPDHFLPESYTC 4850
            |||:.:.....::|:..|:||.|..|:|  :..|      .|..  |..:|:...:::||.|:||
 Worm   702 WFWQWVRSLDQEKRARLLQFVTGTCRVP--VGGFSELMGSTGPQ--LFCIERVGKENWLPRSHTC 762

  Fly  4851 FFLLKMPRYSCKAVLLEKLKYAIHFCKSIDTDEYARVAMGEPTEATGSE 4899
            |..|.:|.|.....|:|||..||                 |.||..|:|
 Worm   763 FNRLDLPPYRSYDQLVEKLSMAI-----------------EMTEGFGNE 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033 90/380 (24%)
HECTc 4553..4878 CDD:214523 81/334 (24%)
wwp-1NP_740775.1 C2 29..147 CDD:301316
WW 221..250 CDD:278809
WW 255..284 CDD:278809
WW 325..357 CDD:197736
WW 367..398 CDD:197736
HECTc 440..792 CDD:238033 92/394 (23%)
HECTc 463..791 CDD:214523 85/356 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.