DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and VAM3

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_014749.1 Gene:VAM3 / 854273 SGDID:S000005632 Length:283 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:74/317 - (23%)
Similarity:130/317 - (41%) Gaps:52/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LELQDDYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQR---DDECDIEVLSQ 108
            :|.|...|      :..:|.|::.::   |..||.:      |...|.:|.   :.||     ::
Yeast     6 IEAQSSKG------NSQQEPQFSTNQ---KTKELSN------LIETFAEQSRVLEKEC-----TK 50

  Fly   109 IVSKLITSTHRH---IQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQLNS 170
            |.||..:...|:   .:.:.:...|..|:|..:.::.........:.|..|:::.|.:|    |.
Yeast    51 IGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSY----NQ 111

  Fly   171 REE--RSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAI 233
            |:.  ..:.....|......|:....|...|..|:...|.....|.|.....|...|...:||  
Yeast   112 RKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQ-- 174

  Fly   234 DDHFQRPPASRMTQQQLLLFEEE---NTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTV 295
                        .|||..|.:||   .|.:.|.|.|::.:|..::.::|.||..||.:|:|||..
Yeast   175 ------------EQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQ 227

  Fly   296 LDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMC--VILVLAAVTFFMLLLLILT 350
            :..||.|:......:....:||.:|:.:|| :|..|  |.|::..|...::||.:|:
Yeast   228 VTTIDENISHLHDNMQNANKQLTRADQHQR-DRNKCGKVTLIIIIVVCMVVLLAVLS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 18/57 (32%)
VAM3NP_014749.1 COG5325 1..267 CDD:227635 69/299 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.