DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and STX7

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001313507.1 Gene:STX7 / 8417 HGNCID:11442 Length:261 Species:Homo sapiens


Alignment Length:258 Identity:70/258 - (27%)
Similarity:122/258 - (47%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SQIVSKLITSTHRHIQCVRSSIGVGSKMEQCLTVN---AVHCALLQLQELTVKFRASQNAYLLQL 168
            :|:..::.::..:..||   |:.:...:.|..|..   .:...|.|.|:.|.:.....:.|:.:.
Human    12 AQLAQRISSNIQKITQC---SVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEF 73

  Fly   169 NS-----REERSQKYFDDGGGAGAGDVFTNVE-LGEQSAENFVDSFDNFLQPPAEGKSGNGYLFE 227
            .|     .|:|.:|...|...|......||.: :..|:||...:    |:.........:|...|
Human    74 GSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKE----FVARVRASSRVSGSFPE 134

  Fly   228 DDEQAIDDHFQRPPAS--RMTQQQLLLFEEENT----RVAQHREQEVTKIVKSIYDLNDIFKDLG 286
            |..:      :|...|  ..||.|:.:.:||.|    |:...||..:.::...|.|:|:||||||
Human   135 DSSK------ERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLG 193

  Fly   287 HMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRK-MCVILVLAAVTFFMLLLLI 348
            .|:.|||.|:|.|:.|||..:..|.:..:||.:|..||||:|| :|:|:::..:...::.|:|
Human   194 MMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLII 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 24/57 (42%)
STX7NP_001313507.1 Syntaxin_2 18..119 CDD:373109 21/107 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..148 5/24 (21%)
SNARE_syntaxin7 168..227 CDD:277228 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.