DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Stx12

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006239128.1 Gene:Stx12 / 65033 RGDID:620977 Length:321 Species:Rattus norvegicus


Alignment Length:271 Identity:65/271 - (23%)
Similarity:110/271 - (40%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PAFDDQRDDECDIEVLSQIVSKLITSTHRHIQCVRSSIGV---GSKMEQCLTVNAVHCALLQLQE 152
            |:....||....|:..|..:.::..:| ..|:.:.|.:|.   .||:::         .|.|.|.
  Rat    14 PSGPQPRDFNSIIQTCSGNIQRISQAT-AQIKNLMSQLGTKQDSSKLQE---------NLQQFQH 68

  Fly   153 LTVKFRASQNAYL-------LQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDN 210
            .|.:.....|..|       |.|::.|:|.||.                 ..|:...:|..:.:|
  Rat    69 STNQLAKETNELLKELGSLPLPLSASEQRQQKL-----------------QKERLMNDFSSALNN 116

  Fly   211 F-----------LQPPAEGKSGNGYLFED---DEQAI--DDHFQ------RPPASRMTQQQLLLF 253
            |           .:..|..::|:....||   :||.:  |.|.:      :...:.:|:|.|.|.
  Rat   117 FQVVQRKVSEKEKESIARARAGSRLSAEDRQREEQLVSFDSHEEWNQMQSQEEEAAITEQDLELI 181

  Fly   254 EEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLH 318
            :|        ||..:.::...|.|:|.|||||..|:.:||.::|.|:.|||.::..|.....||.
  Rat   182 KE--------RETAIQQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERASDQLQ 238

  Fly   319 KAEMYQRKNRK 329
            :|..||...|:
  Rat   239 RAAYYQDLRRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 21/57 (37%)
Stx12XP_006239128.1 SynN 21..164 CDD:238105 33/169 (20%)
Syntaxin 26..213 CDD:279182 48/221 (22%)
SNARE_syntaxin12 181..244 CDD:277229 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.