DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Stx7

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_068641.2 Gene:Stx7 / 60466 RGDID:619747 Length:261 Species:Rattus norvegicus


Alignment Length:261 Identity:67/261 - (25%)
Similarity:121/261 - (46%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LSQIVS---KLITSTHRHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYL-- 165
            |:|.:|   :.||.....||...:.:|......:      :...|.|.|:.|.:.....:.|:  
  Rat    14 LAQRISSNIQKITQCSAEIQRTLNQLGTPQDTPE------LRQQLQQEQQYTNQLAKETDKYIKE 72

  Fly   166 ---LQLNSREERSQKYFDDGGGAGAGDVFTNVE-LGEQSAE---NFVDSFDNFLQPPAEGKSGNG 223
               |.....|:|.:|...|...|......||.: :..|:||   .||      .:..|..:...|
  Rat    73 FGFLPTTPSEQRQRKIQKDRLVAEFTTALTNFQKVQRQAAEREKEFV------ARVRASSRVSGG 131

  Fly   224 YLFEDDEQAIDDHF-----QRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFK 283
            :   .::.:.:.:|     |..|..::..:::   .|::.|:...||..:.::...|.|:|:|||
  Rat   132 F---PEDSSKEKNFVSWESQTQPQVQVQDEEI---TEDDLRLIHERESSIRQLEADIMDINEIFK 190

  Fly   284 DLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRK-MCVILVLAAVTFFMLLLL 347
            |||.|:.|||.|:|.|:.|||..:..|.:..:||.:|..||||:|| :|:|:::..|...::..:
  Rat   191 DLGMMIHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQRKSRKTLCIIILILVVGIVIIFFI 255

  Fly   348 I 348
            :
  Rat   256 V 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 24/57 (42%)
Stx7NP_068641.2 Syntaxin_2 18..119 CDD:405246 22/106 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..148 2/22 (9%)
SNARE_syntaxin7 168..227 CDD:277228 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.