DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Stx7

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001345492.1 Gene:Stx7 / 53331 MGIID:1858210 Length:261 Species:Mus musculus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:120/254 - (47%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SQIVSKLITSTHRHIQCVRSSIGVGSKMEQCLTVN---AVHCALLQLQELTVKFRASQNAYLLQL 168
            :|:..::.::..:..||   |:.:...:.|..|..   .:...|.|.|:.|.:.....:.|:.:.
Mouse    12 AQLAQRISSNIQKITQC---SVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEF 73

  Fly   169 NS-----REERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFED 228
            .|     .|:|.:|...|...|......||.:..::.|......|  ..:..|..:...|:. ||
Mouse    74 GSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKAQRQAAEREKEF--VARVRASSRVSGGFP-ED 135

  Fly   229 ---DEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQ 290
               ::..:....|..|..::..:::   .|::.|:...||..:.::...|.|:|:||||||.|:.
Mouse   136 SSKEKNLVSWESQTQPQVQVQDEEI---TEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIH 197

  Fly   291 EQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRK-MCVILVLAAVTFFMLLLLI 348
            |||.::|.|:.|||..:..|.:..:||.:|..||||:|| :|:|:.:..|...::.|::
Mouse   198 EQGDMIDSIEANVESAEVHVQQANQQLSRAADYQRKSRKTLCIIIFILVVGIVIICLIV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 23/57 (40%)
Stx7NP_001345492.1 SynN 13..150 CDD:238105 26/142 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..148 3/20 (15%)
SNARE_syntaxin7 168..227 CDD:277228 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.