DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and stx17

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005158110.1 Gene:stx17 / 492808 ZFINID:ZDB-GENE-041114-164 Length:292 Species:Danio rerio


Alignment Length:285 Identity:58/285 - (20%)
Similarity:99/285 - (34%) Gaps:84/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVSKLITSTHRHI 121
            |..|::..:.|:.:.|.: :..:...||..|:                           ::.|.:
Zfish    27 PTDLERLHQHQHNIEKFQ-RNRQWDKLHHEHI---------------------------NSSRTV 63

  Fly   122 QCVRSSIGVGSKMEQ-CLTVNAVHCALLQLQELTVKFRASQNAY-LLQLNSREERSQKYFDDGGG 184
            |.:||::   .:||: |..|.:|....|:.....::.|||.... .||::|.....|        
Zfish    64 QQLRSNL---REMEKLCGRVRSVDAEALEKLVQPIRDRASAAIQEFLQIHSDAVNRQ-------- 117

  Fly   185 AGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRPPASRMTQQQ 249
                                  :|:..:...||....     |||...        ..|.:||.|
Zfish   118 ----------------------NFNEAIATVAETSHS-----EDDTGV--------SGSPVTQTQ 147

  Fly   250 LLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGL 314
            |||.|..:   .|:..:....:.:.:..||.:..:...:|..|...:|.|:.||......|.||.
Zfish   148 LLLPEIPS---EQNAAESWDSLAEDLLQLNGLVNEFSTIVHAQQEKIDSIEANVSIAAANVEEGT 209

  Fly   315 RQLHKAEMYQRKNRKMCVILVLAAV 339
            :.|.||     ...|:.|:.|..||
Zfish   210 QSLGKA-----ARAKLAVLPVAGAV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 13/57 (23%)
stx17XP_005158110.1 SNARE_syntaxin17 153..214 CDD:277199 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.