DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Syx1A

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster


Alignment Length:306 Identity:69/306 - (22%)
Similarity:134/306 - (43%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EEGLELQDDYGTPPAWLDKF----EEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIE 104
            ||..|:..:.....:::|.|    ||.:..:.|::..::|:...|:..|..|..|::...|    
  Fly    17 EEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQE---- 77

  Fly   105 VLSQIVSKLITSTHRHIQCVRSSI-GVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQL 168
             |..:::.:..:.:|    ||..: |:...:||....|.        ....::.|.:|::.|   
  Fly    78 -LEDLMADIKKNANR----VRGKLKGIEQNIEQEEQQNK--------SSADLRIRKTQHSTL--- 126

  Fly   169 NSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAE--GKSGNGYLFEDDEQ 231
                  |:|:.         :|.|..   .::..::.:.....:|...|  |:..|     ||| 
  Fly   127 ------SRKFV---------EVMTEY---NRTQTDYRERCKGRIQRQLEITGRPTN-----DDE- 167

  Fly   232 AIDDHFQRPPASRMTQQQLLLFEEENTRVA--QHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGT 294
             ::...:...:|..||..::..::....:|  :.|.|::.|:..||.:|:|:|.|:..:|:.||.
  Fly   168 -LEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGE 231

  Fly   295 VLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRK-NRKMCVILVLAAV 339
            ::|||:|:||.....|....:...||..||.| .||..:||:...|
  Fly   232 MIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 20/59 (34%)
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 47/241 (20%)
SNARE 231..281 CDD:399038 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.