DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and stx12

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_009292402.1 Gene:stx12 / 415141 ZFINID:ZDB-GENE-040625-11 Length:267 Species:Danio rerio


Alignment Length:272 Identity:70/272 - (25%)
Similarity:119/272 - (43%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DQRDDECDIEVLSQIVSKLITSTHRHIQCVRSSIG-VGSKMEQCLTVNAVHCALLQLQELTVKFR 158
            |||....|...|.|..|..|.....:...::..:. :|:|::    .:.:...|..:|..|.:..
Zfish     7 DQRASPKDFSSLIQTCSSNIQKITLNTAQIKGLVNQLGTKLD----TSGLRERLQYMQHHTNQLA 67

  Fly   159 ASQNAYLLQLNS-------REERSQKYFDD---GGGAGAGDVFTNVELGEQSAENFVDSFDNFLQ 213
            ...|.:|..|.|       .|:|.||...|   ...:.|.:.|..|:  .|:||...:|.     
Zfish    68 KETNKHLKDLGSISLPVSLSEQRQQKIQKDRLMNDFSAALNNFQAVQ--RQAAEKEKESV----- 125

  Fly   214 PPAEGKSGNGYLFED---DEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSI 275
              |..::|:....:|   |||.:............||.:.:...||:..:.:.||..:.::...|
Zfish   126 --ARARAGSRLSADDGGHDEQLVSFDNNDDWGKTTTQTEDVAITEEDLELIKERETAIRQLESDI 188

  Fly   276 YDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMCVILVLAAVT 340
            .|:|.|||||..|:.:||.::|.|:.|||..:..|..|..||.:|..||:|:||....|.:....
Zfish   189 LDVNQIFKDLAVMIHDQGEMIDSIEANVESAEVHVERGAEQLQRAAQYQQKSRKKICFLAVGLSI 253

  Fly   341 FFMLLLLILTKL 352
            ..:::.:::.||
Zfish   254 VVLIIGIVIWKL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 22/57 (39%)
stx12XP_009292402.1 Syntaxin_2 23..125 CDD:291208 22/107 (21%)
SNARE_syntaxin12 174..240 CDD:277229 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.