DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and stx12

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_998883.1 Gene:stx12 / 407856 XenbaseID:XB-GENE-974475 Length:267 Species:Xenopus tropicalis


Alignment Length:290 Identity:79/290 - (27%)
Similarity:119/290 - (41%) Gaps:77/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RDDECDIEVLSQIVSKLITSTHRHIQCVRSSIGV---GSKMEQCLTVNAVHCALLQLQELTVKFR 158
            ||....|:..|..|.: ||:....|:.:.:.:|.   .:|::|         .|.|:|..|....
 Frog    12 RDFNSIIQTCSGNVQR-ITNNTAQIRTLLNQLGTSQDSTKLQQ---------NLQQIQHSTNVLA 66

  Fly   159 ASQNAYLLQLNS-------REERSQK---------------YF------------DDGGGAGAGD 189
            ...|.||..|.|       .|:|.||               :|            :....|.|| 
 Frog    67 KETNTYLKDLASVPTPLSPAEQRQQKLQKERLMNDFSAALNHFQAIQRQVSTKEKETVARARAG- 130

  Fly   190 VFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRPPASRMTQQQLLLFE 254
              :.:...|:..|..:.||||       .:..|....:|:|.|:            |::.|.|.:
 Frog   131 --SRLSADERQKEEQLVSFDN-------NEDWNQLQSQDEEFAV------------TEEDLELIK 174

  Fly   255 EENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHK 319
            |        ||..:.|:...|.|:|.|||||..|:.:||.::|.|:.|||..:..|..|..||.:
 Frog   175 E--------RESAIQKLEADILDVNQIFKDLAVMIHDQGEMIDSIEANVESAEVHVERGTEQLQR 231

  Fly   320 AEMYQRKNRKMCVILVLAAVTFFMLLLLIL 349
            |..||:|:||...|||||.....::|.||:
 Frog   232 AAYYQKKSRKKICILVLALAIAAVILGLII 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 23/57 (40%)
stx12NP_998883.1 Syntaxin_2 22..124 CDD:373109 22/111 (20%)
SNARE_syntaxin12 173..239 CDD:277229 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.