DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Syx6

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster


Alignment Length:346 Identity:63/346 - (18%)
Similarity:127/346 - (36%) Gaps:97/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ELQDDYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVSK 112
            ||.::.||         ||::|.:::            |:.||....|..|.|..|.::.:..||
  Fly    46 ELGENGGT---------EAEWTTTEL------------RNSLRSIEWDLEDLEDTISIVEKNPSK 89

  Fly   113 -------------LITSTHRHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQN-A 163
                         .|.:|...::.::..:.:....::.:|.:         |.|....|.|.| .
  Fly    90 FRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAH---------QPLLDNDRHSPNHN 145

  Fly   164 YLLQLNSREERSQKYFD-------------DGGG-AGAGDVFTNVELGEQSA------------- 201
            :.:.:.:....|.:|..             :|.. ..:|....|...|..||             
  Fly   146 HSIAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKY 210

  Fly   202 ---ENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQH 263
               ||.:||      |...|::.:|        .:|....|.....::.||         |:.|.
  Fly   211 SKLENALDS------PSHYGQTHHG--------GMDSPSHRYVGETVSIQQ---------RMIQG 252

  Fly   264 REQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNR 328
            :::::..|..||..|..:.:.:|..:.||..:||......:.|::::...::::.|........|
  Fly   253 QDEQLDMISDSIGTLKTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKR 317

  Fly   329 KMCVILVLAAVTFFMLLLLIL 349
            :...||:|:.:..|:::|.|:
  Fly   318 QWAAILILSGLLLFVIILFII 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 11/57 (19%)
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 18/89 (20%)
SNARE_Syntaxin6 250..315 CDD:277204 12/64 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.