DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Syx13

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster


Alignment Length:264 Identity:63/264 - (23%)
Similarity:109/264 - (41%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LSQIVSKLITSTHRHIQCVRSSIG-VGSKMEQ------CLTVNAVHCALLQ-----LQELTVKFR 158
            ||:.:...||:.|...:.:...:. :|:..||      ..|:|....|.:|     ||.|....|
  Fly    50 LSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQAVVR 114

  Fly   159 ASQNAYLLQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNG 223
            .......|||    |:..:.|.     |..:.::|::....||..                    
  Fly   115 HGDRQQKLQL----EKLTREFH-----GVVEKYSNLQRRISSAMR-------------------- 150

  Fly   224 YLFEDDEQAIDDHFQRPPASRMTQQQLL----LFEEENTRVAQHREQEVTKIVKSIYDLNDIFKD 284
            ...:..:|..|...:....:.:.|||.|    |.:|.:  :...|.::|.:|...|.|:|.|...
  Fly   151 QTLQQAQQFADQVVETNARAELLQQQRLEQAHLQQEHD--MLDDRRRQVEQIESDIIDVNQIMTQ 213

  Fly   285 LGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHK-AEMYQRKNRKMCVILVLAAVTFFMLLLLI 348
            |..:|.:||..:|.|:.::|||...|.:|..:|.| |...|...||:.::||:|.:...::..:|
  Fly   214 LSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTGVI 278

  Fly   349 LTKL 352
            :.||
  Fly   279 VAKL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 19/57 (33%)
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 23/127 (18%)
SNARE_syntaxin7_like 190..249 CDD:277200 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.