DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Syx17

DIOPT Version :10

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster


Alignment Length:59 Identity:15/59 - (25%)
Similarity:23/59 - (38%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IGFYEAGDDESFQ-NVLKCGALRSMDNEYLRVMKILKAPSGNAGLGDGQE-DDDDEGLC 145
            ||......||.|. ...|.|.: :...|.|.....:..|:.::.||...: :|...|.|
  Fly   181 IGDNTIARDELFSYRDFKSGEI-TKSGELLSFCPAIHGPADSSDLGKSFDMEDKASGEC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 COG5325 <212..343 CDD:227635
SNARE_syntaxin16 261..319 CDD:277198
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.