DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and Syx7

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:126/277 - (45%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ECDIEVLSQIVSKLITSTHRHIQCVRSSIGVGSKMEQCLTVNAVHC---------ALLQLQELTV 155
            |.|.:.|:||::   ||    ||.|:.::....:|     ||.::.         .|.|:...|.
  Fly    20 EIDFQRLAQIIA---TS----IQKVQQNVSTMQRM-----VNQLNTPQDSPELKKQLHQIMTYTN 72

  Fly   156 KFRASQNAYLLQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFV-------------DS 207
            :.....|..:.:::..:||..|...|    ...|.||......||.:...             ||
  Fly    73 QLVTDTNNQINEVDKCKERHLKIQRD----RLVDEFTAALTAFQSVQRKTADIEKTALRQARGDS 133

  Fly   208 FDNFLQPPAEGKSG--NGYLFEDDEQAI--DDHFQRPPASRMTQQQLLLFEEENTRVAQHREQEV 268
            : |..:||...::|  |....:.|..:.  |:.|.|  .|...|.|..:.|:.:.:..:.:||.:
  Fly   134 Y-NIARPPGSSRTGSSNSSASQQDNNSFFEDNFFNR--KSNQQQMQTQMEEQADLQALEEQEQVI 195

  Fly   269 TKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMCVI 333
            .::..:|..:|:|:|.||.:|.|||..:|.|:..||||...||:|...|.||..|:.|.||..:|
  Fly   196 RELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLI 260

  Fly   334 LV--LAAVTFFMLLLLI 348
            ||  |:||...::|:|:
  Fly   261 LVGILSAVLLAIILILV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 22/57 (39%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 21/111 (19%)
COG5325 <97..276 CDD:227635 56/185 (30%)
SNARE 188..247 CDD:304603 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.