DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx16 and STX12

DIOPT Version :9

Sequence 1:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_803173.1 Gene:STX12 / 23673 HGNCID:11430 Length:276 Species:Homo sapiens


Alignment Length:286 Identity:68/286 - (23%)
Similarity:124/286 - (43%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PAFDDQRDDECDIEVLSQIVSKLITSTHRHIQCVRSSIGV---GSKMEQCLTVNAVHCALLQLQE 152
            |:....||....|:..|..:.::..:| ..|:.:.|.:|.   .||:::         .|.|||.
Human    14 PSGPQLRDFSSIIQTCSGNIQRISQAT-AQIKNLMSQLGTKQDSSKLQE---------NLQQLQH 68

  Fly   153 LTVKFRASQNAYLLQLNS----------REERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDS 207
            .|.:.....|..|.:|.|          |::|.||                    |:...:|..:
Human    69 STNQLAKETNELLKELGSLPLPLSTSEQRQQRLQK--------------------ERLMNDFSAA 113

  Fly   208 FDNF-----------LQPPAEGKSGNGYLFED---DEQAIDDHFQRPPASRMTQQQLLLFEEENT 258
            .:||           .:..|..::|:....|:   :||.:............:|:..:...|::.
Human   114 LNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDL 178

  Fly   259 RVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMY 323
            .:.:.||..:.::...|.|:|.|||||..|:.:||.::|.|:.|||.::..|.....||.:|..|
Human   179 ELIKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYY 243

  Fly   324 QRKNR-KMCVILVLAAVTFFMLLLLI 348
            |:|:| |||:::::.:|...:|.|:|
Human   244 QKKSRKKMCILVLVLSVIILILGLII 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 21/57 (37%)
STX12NP_803173.1 Syntaxin_2 30..132 CDD:373109 24/131 (18%)
SNARE_syntaxin12 181..247 CDD:277229 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.