DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0004 and PNO1

DIOPT Version :9

Sequence 1:NP_608387.1 Gene:l(1)G0004 / 33033 FlyBaseID:FBgn0027334 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_064528.1 Gene:PNO1 / 56902 HGNCID:32790 Length:252 Species:Homo sapiens


Alignment Length:254 Identity:143/254 - (56%)
Similarity:184/254 - (72%) Gaps:22/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAENIRAD------AFEPAKRATKR-----GASGGGQQDVEMQVDEATGIEGQVLGSSRASAPP 54
            ||.::.||:      ..:..:||.||     .|:|.|.....|..:||.       .:.|...||
Human     5 METQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEAR-------PAKRPVFPP 62

  Fly    55 KA----KRARSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDI 115
            ..    ...:.|.||:.||.:||:.|||:|||||||:|||:.||||||:|:|.||:|...||.|:
Human    63 LCGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRTCKETKDV 127

  Fly   116 ANLQRGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTKF 180
            :.|.:.||||:||:.||:|:|||||:||:|||:|||||.|||.|:|||.||||||:|||||:|||
Human   128 SALTKAADFVKAFILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIAGKGGKTKF 192

  Fly   181 TIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLRAVASRLSER 239
            ||||||:|||||||.|:|||||:|||::||.|:||||||:||||||||:||||||.::|
Human   193 TIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSADR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)G0004NP_608387.1 Krr1 61..239 CDD:224019 125/177 (71%)
KH 165..217 CDD:197652 41/51 (80%)
PNO1NP_064528.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 17/72 (24%)
KH-I_PNO1_rpt1 73..152 CDD:411819 47/78 (60%)
KH-I_PNO1_rpt2 154..249 CDD:411820 76/94 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147120
Domainoid 1 1.000 268 1.000 Domainoid score I1865
eggNOG 1 0.900 - - E1_COG1094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6961
Inparanoid 1 1.050 269 1.000 Inparanoid score I3029
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53604
OrthoDB 1 1.010 - - D1269649at2759
OrthoFinder 1 1.000 - - FOG0005076
OrthoInspector 1 1.000 - - oto89536
orthoMCL 1 0.900 - - OOG6_101323
Panther 1 1.100 - - LDO PTHR12826
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R943
SonicParanoid 1 1.000 - - X3599
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.