DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0004 and pno1

DIOPT Version :9

Sequence 1:NP_608387.1 Gene:l(1)G0004 / 33033 FlyBaseID:FBgn0027334 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_956842.2 Gene:pno1 / 393520 ZFINID:ZDB-GENE-040426-1419 Length:252 Species:Danio rerio


Alignment Length:242 Identity:140/242 - (57%)
Similarity:180/242 - (74%) Gaps:23/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DAFEPAKRATKRGASGGGQQDVEMQVDEATGIEGQVLGSSRASAPPKAKR-----------ARSE 62
            :|||..| :.||........:::.|.:|           |.:|||.|...           ...|
Zfish    22 EAFEKVK-SKKREKRKRAAAEMDTQTEE-----------SSSSAPVKRPHFPALSGDQLGGGVDE 74

  Fly    63 LRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDIANLQRGADFVRA 127
            :|||.||.|||:.|||:|:|||||:||:::||:|||:|.||||::...||.||..|.|.||||:|
Zfish    75 MRKVPVPSHRYTPLKENWLKIFTPIVENLQLQVRFNLKTRQVEIKTCKETQDIGALTRAADFVKA 139

  Fly   128 FLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTKFTIENVTKTRIVL 192
            |:.||:|:|||||:||::||:|:|::.|||.|:|||.||||||:|||||:|||||||||||||||
Zfish   140 FVLGFQVEDALALIRLDELFLETFDVTDVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTKTRIVL 204

  Fly   193 ADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLRAVASRLSER 239
            ||:|||||||:|||::||.|:||||||||||||||||||||:|.:||
Zfish   205 ADTKIHILGSFQNIKMARTAICNLILGSPPSKVYGNLRAVATRSAER 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)G0004NP_608387.1 Krr1 61..239 CDD:224019 125/177 (71%)
KH 165..217 CDD:197652 43/51 (84%)
pno1NP_956842.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 13/61 (21%)
Krr1 74..251 CDD:224019 125/176 (71%)
KH 177..229 CDD:197652 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6961
Inparanoid 1 1.050 270 1.000 Inparanoid score I2988
OMA 1 1.010 - - QHG53604
OrthoDB 1 1.010 - - D1269649at2759
OrthoFinder 1 1.000 - - FOG0005076
OrthoInspector 1 1.000 - - oto40131
orthoMCL 1 0.900 - - OOG6_101323
Panther 1 1.100 - - LDO PTHR12826
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R943
SonicParanoid 1 1.000 - - X3599
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.