DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0004 and Krr1

DIOPT Version :9

Sequence 1:NP_608387.1 Gene:l(1)G0004 / 33033 FlyBaseID:FBgn0027334 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001101564.1 Gene:Krr1 / 314830 RGDID:1306183 Length:380 Species:Rattus norvegicus


Alignment Length:227 Identity:46/227 - (20%)
Similarity:95/227 - (41%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAKRATKRGASGGGQQDVEMQVDEATGIEGQVL---GSSRASAPPKAKRARSELRKVS----VPP 70
            |||.|.|   |...||..:.:..:    ||::|   ...:..|..|....|..|.:.|    .|.
  Rat     8 PAKEARK---SDSRQQKQKRENQD----EGELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPK 65

  Fly    71 HRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDIANLQRGADFVRAFLCGFEVD 135
            :|.:.|||.|..:...:.|| .::...::....:.:....:|.|...:.|..|.::........:
  Rat    66 YREAYLKECWPLVQKALNEH-HVKATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFE 129

  Fly   136 DALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTKFTIENVTKTRIVLADSKIHIL 200
            .|:.:|: :|:..:..:|..:...:.....|. .||.|..|.|...:|.:|...:::..:.:..:
  Rat   130 QAIRILQ-DDVACDIIKIGSLVRNKERFVKRR-QRLIGPKGSTLKALELLTNCYVMVQGNTVSAI 192

  Fly   201 GSYQNIQLARRAVCNLILGSPPSKVYGNLRAV 232
            |.:..::..|:.|.:.:....|  :| |::.:
  Rat   193 GPFSGLKEVRKVVLDTMKNIHP--IY-NIKTL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)G0004NP_608387.1 Krr1 61..239 CDD:224019 32/176 (18%)
KH 165..217 CDD:197652 11/51 (22%)
Krr1NP_001101564.1 Krr1 55..240 CDD:224019 31/173 (18%)
KH 157..207 CDD:197652 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.