DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and AT5G58120

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_200620.1 Gene:AT5G58120 / 835924 AraportID:AT5G58120 Length:1046 Species:Arabidopsis thaliana


Alignment Length:435 Identity:75/435 - (17%)
Similarity:156/435 - (35%) Gaps:138/435 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKE- 111
            |.|::        .|.:....:|.|:       |||.:      |:.:...|:..:.|:.|..| 
plant   370 GFEKL--------AERVTWLCSNLPL-------GLRVM------GSTLRGKKEDDWEGILRRLEN 413

  Fly   112 ---------LSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPL 167
                     |.:.|..|....||.:.      .|....|         :....::|.:|:.:|..
plant   414 SLDRKIDGVLRVGYDHLCEDDQFLYL------LIAFFFN---------YVDDDHVKAMLVEDNLD 463

  Fly   168 IR--IDSSAFSSLTNV---GHLILPSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFT--FRGL 225
            ::  :.:.|:.||..:   |::::...::.:.::|....:..  .:...:|.:|:....  .:|.
plant   464 VKLGLKTLAYKSLIQISAEGNIVMHKLLQRVGREAIQRQEPT--KRRILIDAREICDVLRYGKGT 526

  Fly   226 SNVLLLTLQESDLG--VICADAFTGLTQVETLQILNNKIDS------------------------ 264
            |||..::...||:.  .|..|||..|..:..|::..::.|.                        
plant   527 SNVSGISFDTSDMSEVTISDDAFKRLHDLRFLKVTKSRYDGKYRMHIPAGIEFPCLLRLLHWEAY 591

  Fly   265 -------------IEELN---------FTSTAAIKHLK----FFGNHVLETPDPNS------IIV 297
                         :.|||         ::.|.::::||    .:..::.|.||..:      :.:
plant   592 PSKCLPPTFNPEFLVELNMQGSQLEHLWSGTQSLRNLKNMDLGWSPNLKELPDLTNATNLEDLNL 656

  Fly   298 DGVEHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRVMSELDIDSIGR- 361
            :..|.|..:.:.|   .|:|.|.:             |..:|||: |:|   :.:.:::.|:.| 
plant   657 NSCESLVEIPSSF---SHLHKLKN-------------LWMSYCIN-LQV---IPAHMNLVSLERV 701

  Fly   362 ----CSDQLTKGNLGSSAASLALGINSMLLIAVASCAEWRHVRLL 402
                ||.......:.:....|.:..|:...:..||.|.|..:..|
plant   702 TMTGCSRFRKIPVISTHINYLDIAHNTEFEVVHASIALWCRLHYL 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 5/22 (23%)
LRR_5 73..200 CDD:404228 23/141 (16%)
leucine-rich repeat 85..108 CDD:275380 3/22 (14%)
leucine-rich repeat 109..132 CDD:275380 6/32 (19%)
leucine-rich repeat 133..156 CDD:275380 2/22 (9%)
leucine-rich repeat 157..180 CDD:275380 6/24 (25%)
leucine-rich repeat 181..203 CDD:275380 2/24 (8%)
leucine-rich repeat 204..227 CDD:275380 3/24 (13%)
leucine-rich repeat 228..251 CDD:275380 8/24 (33%)
leucine-rich repeat 252..275 CDD:275380 6/68 (9%)
AT5G58120NP_200620.1 PLN03210 12..1040 CDD:215633 75/435 (17%)
leucine-rich repeat 605..627 CDD:275380 4/21 (19%)
leucine-rich repeat 628..650 CDD:275380 5/21 (24%)
leucine-rich repeat 651..674 CDD:275380 4/25 (16%)
leucine-rich repeat 675..697 CDD:275380 7/38 (18%)
leucine-rich repeat 698..718 CDD:275380 3/19 (16%)
leucine-rich repeat 719..742 CDD:275380 6/22 (27%)
leucine-rich repeat 764..786 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282791at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.