DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lgi4

DIOPT Version :10

Sequence 1:NP_608382.2 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001039090.1 Gene:lgi4 / 733906 XenbaseID:XB-GENE-1013883 Length:578 Species:Xenopus tropicalis


Alignment Length:168 Identity:47/168 - (27%)
Similarity:80/168 - (47%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIIALSVVVCLWNSQ----QTETSK----SCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENL 64
            |:|.||:...|:.|.    |.:.::    .||..|.| :...|||:  |...|| ......:.::
 Frog    22 LVIRLSIGTILFLSLLPLCQAKLARPPRWRCPLGCNC-TIDNVLCD--GTTYIP-STFSTDIVSV 82

  Fly    65 ALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAG 129
            ::.:..||:|.|.||....:|:.|.....:...|...||:||..|:.|.|:...::.:::.||.|
 Frog    83 SIMRCRFPVIPPGSFTPSMSLQILLFTSCSFDAIADDAFQGLRNLEYLFIENNRIKSISRNAFRG 147

  Fly   130 LQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPL 167
            |..|..:.|::|.::.:....|.....:|.|.|..|||
 Frog   148 LHLLVHLSLANNHLEFLPRGLFLSLPAVKHIDLQGNPL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_608382.2 leucine-rich repeat 61..84 CDD:275380 6/22 (27%)
LRR_5 73..200 CDD:463839 28/95 (29%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
leucine-rich repeat 133..156 CDD:275380 4/22 (18%)
leucine-rich repeat 157..180 CDD:275380 6/11 (55%)
leucine-rich repeat 181..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
leucine-rich repeat 228..251 CDD:275380
leucine-rich repeat 252..275 CDD:275380
lgi4NP_001039090.1 LRR_8 102..161 CDD:404697 17/58 (29%)
leucine-rich repeat 103..126 CDD:275378 7/22 (32%)
leucine-rich repeat 127..150 CDD:275378 7/22 (32%)
leucine-rich repeat 151..174 CDD:275378 4/22 (18%)
PCC 156..>234 CDD:188093 9/30 (30%)
leucine-rich repeat 175..187 CDD:275378 6/11 (55%)
EPTP 285..323 CDD:461033
EPTP 334..377 CDD:461033
EPTP 381..421 CDD:461033
EPTP 534..572 CDD:461033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.