DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and LRRC4

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_071426.1 Gene:LRRC4 / 64101 HGNCID:15586 Length:653 Species:Homo sapiens


Alignment Length:366 Identity:93/366 - (25%)
Similarity:156/366 - (42%) Gaps:88/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KSCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGLRALKKLSLD 91
            ::||:.|.|.:| ::|:|...||.::| :.:|:....|.|.:||..:|:.|:|..|..|:.|.|.
Human    44 QNCPSVCSCSNQFSKVVCTRRGLSEVP-QGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLG 107

  Fly    92 GNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSN 156
            .|:|.:|:..||.                        ||.:|:|:.|..|.:..|...||...|.
Human   108 RNSIRQIEVGAFN------------------------GLASLNTLELFDNWLTVIPSGAFEYLSK 148

  Fly   157 IKLILLTNNPLIRIDSSAFSSLTNVGHLILP--SGIRSIEQDAFFGMDTVGLLKLAYMDLK---- 215
            ::.:.|.|||:..|.|.||:.:.::..|.|.  ..:..|.:.||.|:..:..|.|...::|    
Human   149 LRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPN 213

  Fly   216 ------------------EVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKI 262
                              |:.|.:|.|||::..|.:..|.:.:|..:||.||..:..|.:.:|.:
Human   214 LTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNL 278

  Fly   263 DSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAEG 327
            .|:....||                    |...:|:    |.|..|.:.|.|.|..|        
Human   279 SSLPHDLFT--------------------PLRYLVE----LHLHHNPWNCDCDILWL-------- 311

  Fly   328 AHNLTDFLQKN-----YCISPLEVNGRVMSELDIDSIGRCS 363
            |..|.:::..|     .|.:|:.:.||.:.|:|..|. :||
Human   312 AWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASF-QCS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 8/22 (36%)
LRR_5 73..200 CDD:404228 35/128 (27%)
leucine-rich repeat 85..108 CDD:275380 8/22 (36%)
leucine-rich repeat 109..132 CDD:275380 2/22 (9%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 8/44 (18%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRRC4NP_071426.1 LRRNT 46..79 CDD:214470 11/33 (33%)
LRR <74..291 CDD:227223 63/260 (24%)
LRR 1 76..97 7/20 (35%)
leucine-rich repeat 77..100 CDD:275380 8/22 (36%)
LRR 2 100..121 8/44 (18%)
leucine-rich repeat 101..124 CDD:275380 10/46 (22%)
LRR 3 124..145 7/20 (35%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
LRR 4 148..169 8/20 (40%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
LRR 5 172..194 5/21 (24%)
leucine-rich repeat 173..197 CDD:275380 6/23 (26%)
LRR 6 197..218 3/20 (15%)
leucine-rich repeat 198..219 CDD:275380 3/20 (15%)
LRR 7 219..240 3/20 (15%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
LRR 8 243..264 5/20 (25%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR 9 267..288 5/40 (13%)
leucine-rich repeat 268..289 CDD:275380 5/40 (13%)
LRRCT 300..351 CDD:214507 15/59 (25%)
IG 359..441 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.