DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and LRRC4C

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001245348.1 Gene:LRRC4C / 57689 HGNCID:29317 Length:640 Species:Homo sapiens


Alignment Length:365 Identity:100/365 - (27%)
Similarity:159/365 - (43%) Gaps:61/365 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLIIALS--VVVCLWNSQQTETSKSCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALT 67
            ||:::||.  ||..|..:|      :||:.|.|.:| ::|:|....|.::| ..:......|.|.
Human    27 LVVLLALQLLVVAGLVRAQ------TCPSVCSCSNQFSKVICVRKNLREVP-DGISTNTRLLNLH 84

  Fly    68 KNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQN 132
            :|...|||.:||..||.|:.|.|..|:|..|            |:.            ||.||.|
Human    85 ENQIQIIKVNSFKHLRHLEILQLSRNHIRTI------------EIG------------AFNGLAN 125

  Fly   133 LSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTNVGHLILP--SGIRSIEQ 195
            |:|:.|..|::..|...||...|.:|.:.|.|||:..|.|.||:.:.::..|.|.  ..:..|.:
Human   126 LNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISE 190

  Fly   196 DAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESD-----LGVICADAFTGLTQVETL 255
            .||.|:..:..|.||..:|:|:...|       .|:.|.|.|     |..|...:|.||..::.|
Human   191 GAFEGLSNLRYLNLAMCNLREIPNLT-------PLIKLDELDLSGNHLSAIRPGSFQGLMHLQKL 248

  Fly   256 QILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLL 320
            .::.::|..||...|.:..::..:....|::...|......:..:|.:.|..|.:.|.|.|..| 
Human   249 WMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWL- 312

  Fly   321 DGPLAEGAHNLTDFLQKN-----YCISPLEVNGRVMSELD 355
                   :..:.|....|     .|.:|..:.||.:.|||
Human   313 -------SWWIKDMAPSNTACCARCNTPPNLKGRYIGELD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 9/22 (41%)
LRR_5 73..200 CDD:404228 41/128 (32%)
leucine-rich repeat 85..108 CDD:275380 6/22 (27%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
leucine-rich repeat 228..251 CDD:275380 9/27 (33%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRRC4CNP_001245348.1 LRRNT 47..80 CDD:214470 9/33 (27%)
PPP1R42 65..235 CDD:411060 58/201 (29%)
LRR 1 77..98 8/20 (40%)
leucine-rich repeat 78..101 CDD:275380 9/22 (41%)
LRR 2 101..122 9/44 (20%)
leucine-rich repeat 102..125 CDD:275380 11/46 (24%)
LRR 3 125..146 8/20 (40%)
leucine-rich repeat 126..149 CDD:275380 7/22 (32%)
LRR 4 149..170 9/20 (45%)
leucine-rich repeat 150..173 CDD:275380 9/22 (41%)
LRR 5 173..195 5/21 (24%)
leucine-rich repeat 174..198 CDD:275380 6/23 (26%)
LRR 6 198..219 6/27 (22%)
leucine-rich repeat 199..220 CDD:275380 7/27 (26%)
LRR_8 220..279 CDD:404697 14/58 (24%)
LRR 7 220..241 6/20 (30%)
leucine-rich repeat 221..244 CDD:275380 8/22 (36%)
LRR 8 244..265 5/20 (25%)
leucine-rich repeat 245..268 CDD:275380 5/22 (23%)
LRR_8 267..>301 CDD:404697 4/33 (12%)
LRR 9 268..289 2/20 (10%)
leucine-rich repeat 269..290 CDD:275380 2/20 (10%)
LRRCT 301..>339 CDD:214507 9/45 (20%)
IG 360..443 CDD:214652
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.