DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lrrc4.2

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001093494.1 Gene:lrrc4.2 / 566572 ZFINID:ZDB-GENE-030131-7997 Length:644 Species:Danio rerio


Alignment Length:376 Identity:100/376 - (26%)
Similarity:173/376 - (46%) Gaps:58/376 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SW-LVLIIALSVVVCLWNSQQTETSK-SCPAECICLS-QTQVLCNTGGLEQIPLRQLPATVENLA 65
            :| ..|:.|:.::|..|:.....:.: :||:.|.|.: ..:|:|....|.::| ..:|||..:|.
Zfish    12 AWNAALLCAVYLMVRSWSVSAAPSGQLTCPSVCFCSNVSNKVVCTRRSLVRVP-PGIPATTRHLN 75

  Fly    66 LTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGL 130
            |.:|:...|:..:|..||.|:.|.|..|:|.:|            |:.            ||:||
Zfish    76 LMENSIETIEAGTFQHLRHLEVLQLGRNSIRQI------------EVG------------AFSGL 116

  Fly   131 QNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTNVGHLILPSGIRSIE- 194
            .:|:|:.|..|::..|...||...|.::.:.|.:||:..|.|.||:.:.::..|.| ..:|.:| 
Zfish   117 NSLNTLELFDNRLTVIPSGAFEYLSKLRELWLRSNPIESIPSYAFNRVPSLMRLDL-GELRKLEY 180

  Fly   195 --QDAFFGMDTVGLLKLAYMDLKEVAPFT-FRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQ 256
              :.||.|:..:..|.|...:|:|:...| ..||..   |.:.|:....:...:|.||..::.|.
Zfish   181 ISEGAFEGLHNLKYLNLGMCNLREMPVLTPLVGLEE---LEMSENYFPELKPGSFRGLKSLKKLW 242

  Fly   257 ILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPD----PNSIIVDGVEHLQLVSNHFPCGCHIH 317
            |:|::|.:||...|....|:..|....|::...|.    |.|.:|:    |.|..|.:.|.|.:.
Zfish   243 IMNSRITTIERNAFDDVTALVELNLAHNNLSSLPHDLFAPLSYLVE----LHLHHNPWRCDCDVV 303

  Fly   318 TLLDGPLAEGAHNLTDFLQKN-----YCISPLEVNGRVMSELDIDSIGRCS 363
            .|        |..|.:::..|     .|.:|..:.||.:.|:| .|..:||
Zfish   304 WL--------AWWLREYIPTNSTCCGRCHTPAYLRGRYLVEVD-QSTFQCS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 6/22 (27%)
LRR_5 73..200 CDD:404228 36/129 (28%)
leucine-rich repeat 85..108 CDD:275380 6/22 (27%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..203 CDD:275380 7/24 (29%)
leucine-rich repeat 204..227 CDD:275380 7/23 (30%)
leucine-rich repeat 228..251 CDD:275380 5/22 (23%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
lrrc4.2NP_001093494.1 leucine-rich repeat 71..94 CDD:275380 6/22 (27%)
LRR_8 72..129 CDD:290566 22/80 (28%)
LRR_RI 74..>276 CDD:238064 62/229 (27%)
leucine-rich repeat 95..118 CDD:275380 11/46 (24%)
leucine-rich repeat 119..142 CDD:275380 7/22 (32%)
LRR_8 141..202 CDD:290566 17/61 (28%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..191 CDD:275380 7/24 (29%)
leucine-rich repeat 192..213 CDD:275380 5/20 (25%)
LRR_8 213..272 CDD:290566 17/61 (28%)
leucine-rich repeat 214..237 CDD:275380 6/25 (24%)
leucine-rich repeat 238..261 CDD:275380 7/22 (32%)
leucine-rich repeat 262..283 CDD:275380 3/20 (15%)
LRRCT 294..345 CDD:214507 14/59 (24%)
IG_like 353..435 CDD:214653
Ig 365..435 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.