DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lrrc4cb

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_005166545.1 Gene:lrrc4cb / 564462 ZFINID:ZDB-GENE-080327-5 Length:631 Species:Danio rerio


Alignment Length:405 Identity:117/405 - (28%)
Similarity:175/405 - (43%) Gaps:70/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLIIALSVVVCLWNSQQTETSKSCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALTKN 69
            |:|.:.|.||..|..:|      :||:.|.|.:| ::|:|...||:.:| ..:......|.|..|
Zfish    30 LLLALQLLVVAGLVRAQ------TCPSVCSCSNQFSKVICTRRGLKDVP-DGVSTNTRYLNLQDN 87

  Fly    70 NFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLS 134
            ...:||.|||..||.|:.|.|..|:|..|            |:.            ||.||.:|:
Zfish    88 QIQVIKVDSFKHLRHLEILQLSRNHIRNI------------EIG------------AFNGLTSLN 128

  Fly   135 TILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTNVGHLILP--SGIRSIEQDA 197
            |:.|..|::..|...||...|.:|.:.|.|||:..|.|.|||.|.::..|.|.  ..:..|...|
Zfish   129 TLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSDAFSRLPSLRRLDLGELKRLSYISSGA 193

  Fly   198 FFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKI 262
            |.|:..:..|.|...:||||.  ..:.|..:..|.:..:.|.||...:|.||..::.|.:::.::
Zfish   194 FQGLSNLRYLNLGMCNLKEVP--NIQPLIRLDELEMSGNQLTVIQPSSFKGLVHLQKLWMMHAQV 256

  Fly   263 DSIEELNFTSTAAIKHLKFFGN------HVLETPDPNSIIVDGVEHLQLVS-NHFPCGCHIHTL- 319
            .:||..:|....:::.|....|      |.|.||         :.|||.|. :|.|..|:...| 
Zfish   257 QTIERNSFDDLHSLRELNLAHNNLTFLPHDLYTP---------LHHLQRVHLHHNPWNCNCDILW 312

  Fly   320 LDGPLAEGAHNLTDFLQKNYCISPLEVNGRVMSELDIDSIGRC----------SDQLTKGNLGSS 374
            |...|.|.....|....:  |.||..:.||.:.||| .|..:|          ...||:|    .
Zfish   313 LSWWLRETVPTNTSCCAR--CNSPPSLKGRYIGELD-QSYFQCYAPVIIEPPVDLNLTEG----M 370

  Fly   375 AASLALGINSMLLIA 389
            ||.|....||:..::
Zfish   371 AAELKCRTNSVTSVS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 9/22 (41%)
LRR_5 73..200 CDD:404228 42/128 (33%)
leucine-rich repeat 85..108 CDD:275380 6/22 (27%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 11/22 (50%)
leucine-rich repeat 181..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
lrrc4cbXP_005166545.1 LRRNT 48..81 CDD:214470 10/33 (30%)
LRR_8 77..137 CDD:290566 25/83 (30%)
leucine-rich repeat 79..102 CDD:275380 9/22 (41%)
LRR_RI 82..>281 CDD:238064 66/224 (29%)
leucine-rich repeat 103..126 CDD:275380 11/46 (24%)
LRR_8 125..180 CDD:290566 20/54 (37%)
leucine-rich repeat 127..150 CDD:275380 7/22 (32%)
leucine-rich repeat 151..174 CDD:275380 11/22 (50%)
leucine-rich repeat 175..199 CDD:275380 6/23 (26%)
leucine-rich repeat 200..221 CDD:275380 7/22 (32%)
LRR_8 221..280 CDD:290566 13/58 (22%)
leucine-rich repeat 222..245 CDD:275380 7/22 (32%)
leucine-rich repeat 246..269 CDD:275380 4/22 (18%)
leucine-rich repeat 270..291 CDD:275380 6/29 (21%)
LRRCT 302..352 CDD:214507 16/52 (31%)
I-set 355..443 CDD:254352 8/35 (23%)
Ig 372..439 CDD:143165 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.