DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lrrc4ba

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_021329717.1 Gene:lrrc4ba / 556747 ZFINID:ZDB-GENE-080327-25 Length:729 Species:Danio rerio


Alignment Length:358 Identity:98/358 - (27%)
Similarity:163/358 - (45%) Gaps:43/358 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLIIALSVVVCLWNSQQTETSKSCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALTKN 69
            |:|::.|.:.:.|...:....:.:|||.|.|.:| ::|:|....||::| ..:......|.|.:|
Zfish    16 LLLLVQLLLRLLLPGQEAVGAASTCPAVCSCSNQASRVICARQHLEEVP-DNISNNTRYLNLQEN 79

  Fly    70 NFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLS 134
            ...:||.|:|..||.|:.|.|..|.|.:|:..||.|||.|..|.:....|.:|...||..|..|.
Zfish    80 TIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLR 144

  Fly   135 TILLSHNQIQRIEGNAFAGTSNIKLILLTN-NPLIRIDSSAFSSLTNVGHLIL-PSGIRSIEQDA 197
            .:.|.:|.|:.:.|.||....:::.:.|.. ..|..|..:||..|.|:.:|.| ..|::.|.   
Zfish   145 ELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIP--- 206

  Fly   198 FFGMDTVGLLKLAYMD-----LKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQI 257
                :...|::|..::     |:.:.|.:|:||.::..|.|..|.:.||..:||..|..:|.|.:
Zfish   207 ----NLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLKNLEELNL 267

  Fly   258 LNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDG 322
            .:|.:.|:.                  |.|.||      :..:|.:.|..|.:.|.|.: ..|..
Zfish   268 SHNSLHSLP------------------HDLFTP------LQKLERVHLNHNPWVCNCDV-LWLSW 307

  Fly   323 PLAEGAHNLTDFLQKNYCISPLEVNGRVMSELD 355
            .|.|...:.|....:  |.:|..:.|:.:.|||
Zfish   308 WLKETVPSNTTCCAR--CHAPPYLKGKYIGELD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 8/22 (36%)
LRR_5 73..200 CDD:404228 42/128 (33%)
leucine-rich repeat 85..108 CDD:275380 10/22 (45%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 6/23 (26%)
leucine-rich repeat 181..203 CDD:275380 4/22 (18%)
leucine-rich repeat 204..227 CDD:275380 7/27 (26%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
lrrc4baXP_021329717.1 LRR <60..280 CDD:227223 68/245 (28%)
leucine-rich repeat 71..94 CDD:275380 8/22 (36%)
leucine-rich repeat 95..118 CDD:275380 10/22 (45%)
leucine-rich repeat 119..142 CDD:275380 7/22 (32%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..191 CDD:275380 6/23 (26%)
leucine-rich repeat 192..213 CDD:275380 5/27 (19%)
leucine-rich repeat 214..237 CDD:275380 6/22 (27%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
leucine-rich repeat 262..283 CDD:275380 8/44 (18%)
TPKR_C2 294..344 CDD:326558 13/48 (27%)
I-set 347..436 CDD:333254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.