DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and Lrrc17

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001020326.1 Gene:Lrrc17 / 502715 RGDID:1560165 Length:446 Species:Rattus norvegicus


Alignment Length:350 Identity:79/350 - (22%)
Similarity:128/350 - (36%) Gaps:102/350 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PATVENLALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMV 122
            |..:.::.|.:|...::|.:.|:..:.||.|.|..|.|::|:..||.||.:|..|.:|:..::::
  Rat    85 PQDLLHMLLARNKIRVLKNNMFSKFKRLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVL 149

  Fly   123 AQFAFAGLQNLSTILLSHN---------------QIQRIE--GN-AFAGT----SNIKLILLTNN 165
            .:..|.....||.:.|..|               ||.|..  || |..|:    .|.||:.|...
  Rat   150 TEEVFIYTPLLSYLRLYDNPWHCACELETLVSMLQIPRNRNLGNYAKCGSPPALRNKKLLQLKPQ 214

  Fly   166 PLI------RIDSSAFSSLTNVGHLILPSGIRSIEQDAFFGMDTVGL------------------ 206
            .|.      |:|  ....::.|..:|.|....::..:..|.:.|:..                  
  Rat   215 ELCDEEEKERLD--PIPQVSGVPAVIRPEADSTLCHNYVFPIQTLDCKRKELKKVPNNIPPNIVK 277

  Fly   207 LKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKIDS-----IE 266
            |.|:|..:.::.|..|..:..:..|.|..:.|..|...||.||..:|.|.:.||.:.|     :|
  Rat   278 LDLSYNKISQLRPKEFEDVHELKKLNLSSNGLEFIDPAAFLGLIHLEELDLSNNSLQSFDYGVLE 342

  Fly   267 ELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAEGAHNL 331
            :|.|        ||.                     |.|..|.:.|...||.|.           
  Rat   343 DLYF--------LKL---------------------LWLRDNPWRCDYSIHYLY----------- 367

  Fly   332 TDFLQKNY--------CISPLEVNG 348
             .:|:.:|        |.:|.|..|
  Rat   368 -YWLKHHYNVHYNGLECKTPEEYKG 391

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 4/22 (18%)
LRR_5 73..200 CDD:404228 38/154 (25%)
leucine-rich repeat 85..108 CDD:275380 11/22 (50%)
leucine-rich repeat 109..132 CDD:275380 4/22 (18%)
leucine-rich repeat 133..156 CDD:275380 11/44 (25%)
leucine-rich repeat 157..180 CDD:275380 6/28 (21%)
leucine-rich repeat 181..203 CDD:275380 4/21 (19%)
leucine-rich repeat 204..227 CDD:275380 5/40 (13%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 8/27 (30%)