DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and CG14762

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:357 Identity:93/357 - (26%)
Similarity:154/357 - (43%) Gaps:81/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGLR-ALKKLSLDGNNITRIKQFAFRGLPRLKE 111
            |||         |:|.|.|.:|....|.|::|.||. .:|:|:|.||::|.|.|.|...|..||:
  Fly   175 GLE---------TLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKK 230

  Fly   112 LSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFS 176
            |.||...::.:::..|.|||:|.:::|:||.|..:..|.|:..:.:..:.|..|.:..||..||.
  Fly   231 LEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFK 295

  Fly   177 SL-TNVGHLIL-PSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVL-LLTLQESDL 238
            .| .|:.:|.| .:.|.:|..:|...:..:..|.|...::..:|...|.|..:.| .|.||::|:
  Fly   296 GLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDI 360

  Fly   239 GVICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHL 303
            .|:.:..|..|..:|||.:.|||:..|.:                    :..:|   ::|.:..:
  Fly   361 KVLPSLLFENLNSLETLNLQNNKLQRIPQ--------------------DIMEP---VIDTLRII 402

  Fly   304 QLVSNHFPCGCHI-------------------------HTLLDGPLAEGAHNLTDFLQ-----KN 338
            .:..|...|.|.:                         |..||        |...|:|     |.
  Fly   403 DITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLD--------NREYFVQAMPTEKM 459

  Fly   339 YC----ISPLEVNGRVMSELDID---SIGRCS 363
            :|    :||...:|.:|..|.::   .|..||
  Fly   460 HCAGLNVSPSPTSGGLMRILQVNILAQIAVCS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 9/23 (39%)
LRR_5 73..200 CDD:404228 44/129 (34%)
leucine-rich repeat 85..108 CDD:275380 10/22 (45%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 7/23 (30%)
leucine-rich repeat 181..203 CDD:275380 5/22 (23%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 228..251 CDD:275380 8/23 (35%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 70/217 (32%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566 18/47 (38%)
leucine-rich repeat 155..178 CDD:275380 3/11 (27%)
leucine-rich repeat 179..203 CDD:275380 9/23 (39%)
leucine-rich repeat 204..227 CDD:275380 10/22 (45%)
LRR_8 226..286 CDD:290566 18/59 (31%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 15/58 (26%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..349 CDD:275380 5/23 (22%)
LRR_8 349..409 CDD:290566 18/82 (22%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.