Sequence 1: | NP_001259742.1 | Gene: | CG1504 / 33028 | FlyBaseID: | FBgn0031100 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258010.1 | Gene: | Lrrc4b / 308571 | RGDID: | 1307121 | Length: | 709 | Species: | Rattus norvegicus |
Alignment Length: | 330 | Identity: | 88/330 - (26%) |
---|---|---|---|
Similarity: | 152/330 - (46%) | Gaps: | 33/330 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 SCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGLRALKKLSLDG 92
Fly 93 NNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNI 157
Fly 158 KLILLTNNPLIRIDSSAFSSLTNVGHLILP--SGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPF 220
Fly 221 TFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNH 285
Fly 286 VLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRV 350
Fly 351 MSELD 355 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1504 | NP_001259742.1 | leucine-rich repeat | 61..84 | CDD:275380 | 7/22 (32%) |
LRR_5 | 73..200 | CDD:404228 | 35/128 (27%) | ||
leucine-rich repeat | 85..108 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 109..132 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 181..203 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 204..227 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 4/22 (18%) | ||
Lrrc4b | NP_001258010.1 | LRRNT | 59..92 | CDD:214470 | 11/33 (33%) |
LRR | <89..299 | CDD:227223 | 60/235 (26%) | ||
LRR 1 | 89..110 | 6/20 (30%) | |||
leucine-rich repeat | 90..113 | CDD:275380 | 7/22 (32%) | ||
LRR 2 | 113..134 | 7/20 (35%) | |||
leucine-rich repeat | 114..137 | CDD:275380 | 10/46 (22%) | ||
LRR 3 | 137..158 | 6/20 (30%) | |||
leucine-rich repeat | 138..161 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 161..182 | 8/20 (40%) | |||
leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
LRR 5 | 185..207 | 5/21 (24%) | |||
leucine-rich repeat | 186..210 | CDD:275380 | 6/23 (26%) | ||
LRR 6 | 210..231 | 5/22 (23%) | |||
leucine-rich repeat | 211..232 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 232..253 | 5/20 (25%) | |||
leucine-rich repeat | 233..256 | CDD:275380 | 7/22 (32%) | ||
LRR 8 | 256..277 | 4/20 (20%) | |||
leucine-rich repeat | 257..280 | CDD:275380 | 4/22 (18%) | ||
LRR 9 | 280..301 | 3/20 (15%) | |||
leucine-rich repeat | 281..302 | CDD:275380 | 3/20 (15%) | ||
LRRCT | 313..363 | CDD:214507 | 14/48 (29%) | ||
I-set | 366..455 | CDD:400151 | |||
Ig strand A | 366..369 | CDD:409353 | |||
Ig strand A' | 373..376 | CDD:409353 | |||
Ig strand B | 382..389 | CDD:409353 | |||
Ig strand C | 395..400 | CDD:409353 | |||
Ig strand C' | 403..405 | CDD:409353 | |||
Ig strand D | 414..418 | CDD:409353 | |||
Ig strand E | 421..425 | CDD:409353 | |||
Ig strand F | 435..442 | CDD:409353 | |||
Ig strand G | 445..455 | CDD:409353 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 496..552 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D180608at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |