DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and Lrrc4b

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001258010.1 Gene:Lrrc4b / 308571 RGDID:1307121 Length:709 Species:Rattus norvegicus


Alignment Length:330 Identity:88/330 - (26%)
Similarity:152/330 - (46%) Gaps:33/330 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGLRALKKLSLDG 92
            ||||.|.|.:| ::|:|....|.::| ..:|.....|.|.:|:..:|:.|:|..||.|:.|.|..
  Rat    58 SCPAACSCSNQASRVICTRRELAEVP-ASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLSK 121

  Fly    93 NNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNI 157
            |.:.:|:..||.|||                        :|:|:.|..|::..:...||...|.:
  Rat   122 NLVRKIEVGAFNGLP------------------------SLNTLELFDNRLTTVPTQAFEYLSKL 162

  Fly   158 KLILLTNNPLIRIDSSAFSSLTNVGHLILP--SGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPF 220
            :.:.|.|||:..|.|.||:.:.::..|.|.  ..:..|.:.||.|:..:..|.|...:||::...
  Rat   163 RELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNL 227

  Fly   221 TFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNH 285
            |  .|..:..|.|..:.|.:|...:|.|||.:..|.:::.::.:||...|....:::.|....|:
  Rat   228 T--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNN 290

  Fly   286 VLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRV 350
            ::..|......:..:|.:.|..|.:.|.|.: ..|...|.|...:.|....:  |.:|..:.||.
  Rat   291 LMSLPHDLFTPLHRLERVHLNHNPWHCNCDV-LWLSWWLKETVPSNTTCCAR--CHAPAGLKGRY 352

  Fly   351 MSELD 355
            :.|||
  Rat   353 IGELD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 7/22 (32%)
LRR_5 73..200 CDD:404228 35/128 (27%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
leucine-rich repeat 109..132 CDD:275380 0/22 (0%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
Lrrc4bNP_001258010.1 LRRNT 59..92 CDD:214470 11/33 (33%)
LRR <89..299 CDD:227223 60/235 (26%)
LRR 1 89..110 6/20 (30%)
leucine-rich repeat 90..113 CDD:275380 7/22 (32%)
LRR 2 113..134 7/20 (35%)
leucine-rich repeat 114..137 CDD:275380 10/46 (22%)
LRR 3 137..158 6/20 (30%)
leucine-rich repeat 138..161 CDD:275380 6/22 (27%)
LRR 4 161..182 8/20 (40%)
leucine-rich repeat 162..185 CDD:275380 8/22 (36%)
LRR 5 185..207 5/21 (24%)
leucine-rich repeat 186..210 CDD:275380 6/23 (26%)
LRR 6 210..231 5/22 (23%)
leucine-rich repeat 211..232 CDD:275380 6/22 (27%)
LRR 7 232..253 5/20 (25%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
LRR 8 256..277 4/20 (20%)
leucine-rich repeat 257..280 CDD:275380 4/22 (18%)
LRR 9 280..301 3/20 (15%)
leucine-rich repeat 281..302 CDD:275380 3/20 (15%)
LRRCT 313..363 CDD:214507 14/48 (29%)
I-set 366..455 CDD:400151
Ig strand A 366..369 CDD:409353
Ig strand A' 373..376 CDD:409353
Ig strand B 382..389 CDD:409353
Ig strand C 395..400 CDD:409353
Ig strand C' 403..405 CDD:409353
Ig strand D 414..418 CDD:409353
Ig strand E 421..425 CDD:409353
Ig strand F 435..442 CDD:409353
Ig strand G 445..455 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 496..552
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.