DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and GP1BA

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_000164.5 Gene:GP1BA / 2811 HGNCID:4439 Length:652 Species:Homo sapiens


Alignment Length:282 Identity:65/282 - (23%)
Similarity:105/282 - (37%) Gaps:82/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SQTQVLCNTGGLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGL---RALKKLSLDGNNITRIK 99
            |..:|.|:...|..:| ..||.....|.|::|   ::...|.|.|   ..|.:|:||...:|:  
Human    27 SHLEVNCDKRNLTALP-PDLPKDTTILHLSEN---LLYTFSLATLMPYTRLTQLNLDRCELTK-- 85

  Fly   100 QFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTN 164
                        |.:..|            |..|.|:.|||||:|.:.            :|...
Human    86 ------------LQVDGT------------LPVLGTLDLSHNQLQSLP------------LLGQT 114

  Fly   165 NPLIRIDSSAFSSLTNVGHLILPSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVL 229
            .|.:.:...:|:.||:     ||.|       |..|:..:..|.|...:||.:.|........:.
Human   115 LPALTVLDVSFNRLTS-----LPLG-------ALRGLGELQELYLKGNELKTLPPGLLTPTPKLE 167

  Fly   230 LLTLQESDLGVICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNS 294
            .|:|..::|..:.|....||..::||.:..|.:.:|.:            .|||:|:|    |.:
Human   168 KLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPK------------GFFGSHLL----PFA 216

  Fly   295 IIVDGVEHLQLVSNHFPCGCHI 316
            .         |..|.:.|.|.|
Human   217 F---------LHGNPWLCNCEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 6/25 (24%)
LRR_5 73..200 CDD:404228 28/129 (22%)
leucine-rich repeat 85..108 CDD:275380 5/22 (23%)
leucine-rich repeat 109..132 CDD:275380 3/22 (14%)
leucine-rich repeat 133..156 CDD:275380 8/22 (36%)
leucine-rich repeat 157..180 CDD:275380 4/22 (18%)
leucine-rich repeat 181..203 CDD:275380 5/21 (24%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 228..251 CDD:275380 6/22 (27%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
GP1BANP_000164.5 LRRNT 19..50 CDD:214470 7/23 (30%)
leucine-rich repeat 30..48 CDD:275380 6/18 (33%)
LRR 1 48..68 5/22 (23%)
leucine-rich repeat 49..72 CDD:275380 6/25 (24%)
LRR_RI <51..200 CDD:238064 46/201 (23%)
LRR_8 71..128 CDD:290566 19/94 (20%)
LRR 2 72..93 7/46 (15%)
leucine-rich repeat 73..94 CDD:275380 8/46 (17%)
LRR 3 94..115 9/32 (28%)
leucine-rich repeat 95..117 CDD:275380 9/33 (27%)
LRR_8 116..176 CDD:290566 16/71 (23%)
LRR 4 117..137 7/31 (23%)
leucine-rich repeat 118..141 CDD:275380 8/34 (24%)
LRR 5 141..162 5/20 (25%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
LRR_8 164..222 CDD:290566 17/82 (21%)
LRR 6 165..186 4/20 (20%)
leucine-rich repeat 166..189 CDD:275380 6/22 (27%)
LRR 7 189..210 6/32 (19%)
leucine-rich repeat 190..210 CDD:275380 6/31 (19%)
leucine-rich repeat 213..225 CDD:275378 4/24 (17%)
LRRCT 221..281 CDD:214507 4/9 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282791at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.