Sequence 1: | NP_001259742.1 | Gene: | CG1504 / 33028 | FlyBaseID: | FBgn0031100 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000164.5 | Gene: | GP1BA / 2811 | HGNCID: | 4439 | Length: | 652 | Species: | Homo sapiens |
Alignment Length: | 282 | Identity: | 65/282 - (23%) |
---|---|---|---|
Similarity: | 105/282 - (37%) | Gaps: | 82/282 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 SQTQVLCNTGGLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGL---RALKKLSLDGNNITRIK 99
Fly 100 QFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTN 164
Fly 165 NPLIRIDSSAFSSLTNVGHLILPSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVL 229
Fly 230 LLTLQESDLGVICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNS 294
Fly 295 IIVDGVEHLQLVSNHFPCGCHI 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1504 | NP_001259742.1 | leucine-rich repeat | 61..84 | CDD:275380 | 6/25 (24%) |
LRR_5 | 73..200 | CDD:404228 | 28/129 (22%) | ||
leucine-rich repeat | 85..108 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 109..132 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 181..203 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 204..227 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 4/22 (18%) | ||
GP1BA | NP_000164.5 | LRRNT | 19..50 | CDD:214470 | 7/23 (30%) |
leucine-rich repeat | 30..48 | CDD:275380 | 6/18 (33%) | ||
LRR 1 | 48..68 | 5/22 (23%) | |||
leucine-rich repeat | 49..72 | CDD:275380 | 6/25 (24%) | ||
LRR_RI | <51..200 | CDD:238064 | 46/201 (23%) | ||
LRR_8 | 71..128 | CDD:290566 | 19/94 (20%) | ||
LRR 2 | 72..93 | 7/46 (15%) | |||
leucine-rich repeat | 73..94 | CDD:275380 | 8/46 (17%) | ||
LRR 3 | 94..115 | 9/32 (28%) | |||
leucine-rich repeat | 95..117 | CDD:275380 | 9/33 (27%) | ||
LRR_8 | 116..176 | CDD:290566 | 16/71 (23%) | ||
LRR 4 | 117..137 | 7/31 (23%) | |||
leucine-rich repeat | 118..141 | CDD:275380 | 8/34 (24%) | ||
LRR 5 | 141..162 | 5/20 (25%) | |||
leucine-rich repeat | 142..165 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 164..222 | CDD:290566 | 17/82 (21%) | ||
LRR 6 | 165..186 | 4/20 (20%) | |||
leucine-rich repeat | 166..189 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 189..210 | 6/32 (19%) | |||
leucine-rich repeat | 190..210 | CDD:275380 | 6/31 (19%) | ||
leucine-rich repeat | 213..225 | CDD:275378 | 4/24 (17%) | ||
LRRCT | 221..281 | CDD:214507 | 4/9 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 336..459 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D282791at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |