DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lron-13

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_499798.2 Gene:lron-13 / 190728 WormBaseID:WBGene00013574 Length:782 Species:Caenorhabditis elegans


Alignment Length:398 Identity:85/398 - (21%)
Similarity:151/398 - (37%) Gaps:100/398 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCPAECICLSQT-QVLCNTGGLEQIPLRQLPAT-VENLALTKNNFPIIKPDSFAGLRALKKLSLD 91
            :||.:|||...: ...|.|....::.:..|.:| :.:|.:...:...::..||||:..:::||..
 Worm    25 TCPRQCICHEHSIACSCETSEKPELIISSLGSTYITSLVVHTCDKVTVQNGSFAGVVLVERLSFI 89

  Fly    92 GNNITRIKQFAFRGL---PRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAG 153
            .......:..||:.:   ||  :|.|....:..:|..:||||.::..:...:::|..|...||..
 Worm    90 AIGRLYFEPHAFKDILQSPR--QLVIDECTISSLAPVSFAGLSHIDHLWFRNSRIDVIATEAFHY 152

  Fly   154 TSNIKLILLTNNPLIRIDSSAFSSLTNVGHLILPSGIR--SIEQDAFFGMDTVGLLKLAYMDLKE 216
            .:||..|......:.||:..|||.:..:.||.....|.  :||.:||.|              .:
 Worm   153 LTNIDYIYFHKTKIGRIERKAFSKMYQIDHLYFKDSIEIATIESEAFSG--------------SQ 203

  Fly   217 VAPFTFRGLS-----NVLLLTLQESDLGVI--CADAFTGLTQVETLQILNNKIDS---------- 264
            |....|.|::     :..||.: |||:.::  |           ::.::..|.|.          
 Worm   204 VDEMIFDGVTVETAHDTFLLNV-ESDMAILKNC-----------SIYLIPRKEDDMVVFDEKQKI 256

  Fly   265 -----IEELNFTSTAAIKHLKFFGNHVLE-----------------TP--DPNSIIVDGVEHLQL 305
                 ||..:|...:..|    .|.:|||                 ||  .|...|:..:..: :
 Worm   257 IERCLIESSSFNIMSPYK----LGCNVLEVTSSVIQRIGPVSRDIDTPVFRPEPFIISSLNSV-I 316

  Fly   306 VSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRVMSELDIDSIGRCSDQLTKGN 370
            .||     |.|            .::..|...||.:|.|..|...:.|:...:|.:  .:::...
 Worm   317 FSN-----CSI------------GSVDSFAFTNYTLSILSFNHSRIGEMKTRTIEK--SKISNFE 362

  Fly   371 LGSSAASL 378
            .|.|...|
 Worm   363 FGGSTVKL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 5/22 (23%)
LRR_5 73..200 CDD:404228 36/131 (27%)
leucine-rich repeat 85..108 CDD:275380 4/25 (16%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
leucine-rich repeat 133..156 CDD:275380 4/22 (18%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..203 CDD:275380 8/23 (35%)
leucine-rich repeat 204..227 CDD:275380 3/27 (11%)
leucine-rich repeat 228..251 CDD:275380 6/24 (25%)
leucine-rich repeat 252..275 CDD:275380 5/37 (14%)
lron-13NP_499798.2 leucine-rich repeat 108..131 CDD:275380 9/24 (38%)
LRR_8 111..160 CDD:290566 13/48 (27%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..201 CDD:275380 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.