Sequence 1: | NP_001259742.1 | Gene: | CG1504 / 33028 | FlyBaseID: | FBgn0031100 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034456.2 | Gene: | Gp1ba / 14723 | MGIID: | 1333744 | Length: | 734 | Species: | Mus musculus |
Alignment Length: | 218 | Identity: | 50/218 - (22%) |
---|---|---|---|
Similarity: | 82/218 - (37%) | Gaps: | 32/218 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LVLIIALSVVVCLWNSQQTETSKSCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENLALTKNN 70
Fly 71 FPIIKPDSF----------------------AGLRALKKLSLDGNNITRIKQFAFRGLPRLKELS 113
Fly 114 IQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSL 178
Fly 179 TNVGHLILP-SGIRSIEQDAFFG 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1504 | NP_001259742.1 | leucine-rich repeat | 61..84 | CDD:275380 | 5/44 (11%) |
LRR_5 | 73..200 | CDD:404228 | 30/149 (20%) | ||
leucine-rich repeat | 85..108 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 109..132 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 181..203 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 204..227 | CDD:275380 | |||
leucine-rich repeat | 228..251 | CDD:275380 | |||
leucine-rich repeat | 252..275 | CDD:275380 | |||
Gp1ba | NP_034456.2 | LRR | 28..>204 | CDD:227223 | 38/177 (21%) |
leucine-rich repeat | 28..47 | CDD:275380 | 5/19 (26%) | ||
LRR 1 | 48..69 | 4/20 (20%) | |||
leucine-rich repeat | 51..72 | CDD:275380 | 4/20 (20%) | ||
LRR 2 | 72..93 | 0/20 (0%) | |||
leucine-rich repeat | 73..94 | CDD:275380 | 1/20 (5%) | ||
LRR 3 | 94..115 | 5/21 (24%) | |||
leucine-rich repeat | 95..117 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 117..140 | 4/22 (18%) | |||
leucine-rich repeat | 118..141 | CDD:275380 | 5/22 (23%) | ||
LRR 5 | 141..162 | 3/20 (15%) | |||
leucine-rich repeat | 142..165 | CDD:275380 | 4/22 (18%) | ||
LRR 6 | 165..188 | 6/22 (27%) | |||
leucine-rich repeat | 166..189 | CDD:275380 | 7/22 (32%) | ||
LRR 7 | 189..210 | 7/22 (32%) | |||
leucine-rich repeat | 190..211 | CDD:275380 | 7/21 (33%) | ||
LRRCT | 221..281 | CDD:214507 | |||
DUF5585 | <257..539 | CDD:375359 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 406..429 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 460..526 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D282791at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |