| Sequence 1: | NP_001259742.1 | Gene: | CG1504 / 33028 | FlyBaseID: | FBgn0031100 | Length: | 425 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001026862.1 | Gene: | LRRC17 / 10234 | HGNCID: | 16895 | Length: | 441 | Species: | Homo sapiens |
| Alignment Length: | 347 | Identity: | 70/347 - (20%) |
|---|---|---|---|
| Similarity: | 113/347 - (32%) | Gaps: | 126/347 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 85 LKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGN 149
Fly 150 AFAGTSNIKLILLTNNP------------LIRIDSSAFSSLTNVGHLILP-----SGIRSIEQDA 197
Fly 198 F-----------------------------------FGMDTVGL------------------LKL 209
Fly 210 AYMDLKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKIDS-----IEELN 269
Fly 270 FTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDF 334
Fly 335 LQKNY--------CISPLEVNG 348 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1504 | NP_001259742.1 | leucine-rich repeat | 61..84 | CDD:275380 | |
| LRR_5 | 73..200 | CDD:404228 | 33/166 (20%) | ||
| leucine-rich repeat | 85..108 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 109..132 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 133..156 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 157..180 | CDD:275380 | 5/34 (15%) | ||
| leucine-rich repeat | 181..203 | CDD:275380 | 4/61 (7%) | ||
| leucine-rich repeat | 204..227 | CDD:275380 | 5/40 (13%) | ||
| leucine-rich repeat | 228..251 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 252..275 | CDD:275380 | 7/27 (26%) | ||
| LRRC17 | NP_001026862.1 | leucine-rich repeat | 63..81 | CDD:275380 | |
| LRR 1 | 82..103 | 6/19 (32%) | |||
| LRR_8 | 84..141 | CDD:290566 | 19/56 (34%) | ||
| leucine-rich repeat | 84..106 | CDD:275380 | 5/21 (24%) | ||
| LRR_4 | 105..146 | CDD:289563 | 16/40 (40%) | ||
| LRR 2 | 106..127 | 6/20 (30%) | |||
| leucine-rich repeat | 107..130 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 130..151 | 9/20 (45%) | |||
| leucine-rich repeat | 131..154 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 155..244 | CDD:275380 | 9/90 (10%) | ||
| leucine-rich repeat | 249..269 | CDD:275380 | 1/19 (5%) | ||
| LRR_RI | <267..>351 | CDD:238064 | 24/112 (21%) | ||
| LRR 4 | 269..290 | 5/20 (25%) | |||
| leucine-rich repeat | 270..293 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 272..328 | CDD:290566 | 17/55 (31%) | ||
| LRR 5 | 293..314 | 5/20 (25%) | |||
| LRR_4 | 294..332 | CDD:289563 | 12/37 (32%) | ||
| leucine-rich repeat | 294..317 | CDD:275380 | 7/22 (32%) | ||
| LRR 6 | 317..340 | 5/22 (23%) | |||
| leucine-rich repeat | 318..341 | CDD:275380 | 6/22 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D282791at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||