DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lrrc17

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_004913080.1 Gene:lrrc17 / 101732309 XenbaseID:XB-GENE-1010987 Length:428 Species:Xenopus tropicalis


Alignment Length:424 Identity:86/424 - (20%)
Similarity:148/424 - (34%) Gaps:134/424 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIALSVVVCLWNSQQTETSKS-----------------------CPAEC-ICLSQTQVLCNTGGL 49
            ::.|.:::|.....:...:||                       .|.|. |.|::..:.|.    
 Frog     3 VVTLLMLLCFCKISECRKTKSNRENGKPNRTKKTSSTVKRYAPGLPCETYIYLNEKYLDCQ---- 63

  Fly    50 EQIPLRQLPATVENL---ALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKE 111
            |:.....|||..|:|   .|.:|...|:|.::|:..:.:|.|.|..|.|.:|:..||.||.||..
 Frog    64 EKRQTSVLPAWPEDLIHILLARNLIRILKNNAFSKFQKVKSLDLQQNEIIKIENLAFYGLKRLTT 128

  Fly   112 LSIQYTPLQMVAQFAFAGLQNLSTILLSHN------------QIQRIEGNAFAGT---------- 154
            |.:|:..::::::..|..|..||.:.|..|            .:.:|..|...|.          
 Frog   129 LLLQHNKIKVLSEEVFIHLPLLSYLRLYDNPWDCNCELESLVTLLKIPRNRNLGNYAKCETPIEM 193

  Fly   155 SNIKLILLT--------------------NNPLIRIDSSAFSSLTNVGHLIL-PSGIRSIEQDAF 198
            ..:||..::                    ..|:  :|||       :.|..| |.......:...
 Frog   194 KGLKLKTVSPELICQDRTMEPQHIEGPKVTRPI--VDSS-------LCHTYLYPVATLDCRRKEL 249

  Fly   199 FGMDT-----VGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQIL 258
            ..:.|     :..|.|:...:|::....|....|:.:|.|..:.:.:|...||:||..::.|.:.
 Frog   250 HSVPTDIAPDIVKLDLSNNKIKQLQSRQFVDTPNLEILNLNSNGIELIDPAAFSGLMNLQELDLS 314

  Fly   259 NNKI-----DSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHT 318
            ||.:     ..:|:|.|                             ::.|.|..|.:.|..:||.
 Frog   315 NNTLFYIHYGVLEDLYF-----------------------------LKKLWLRDNPWRCDYNIHY 350

  Fly   319 LLDGPLAEGAHNLTDFLQKNY----CISPLEVNG 348
            |.        :.|......||    |.||.|..|
 Frog   351 LF--------YWLKHHYNVNYNGLECKSPEEYKG 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 7/25 (28%)
LRR_5 73..200 CDD:404228 35/169 (21%)
leucine-rich repeat 85..108 CDD:275380 10/22 (45%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 7/44 (16%)
leucine-rich repeat 157..180 CDD:275380 6/42 (14%)
leucine-rich repeat 181..203 CDD:275380 3/22 (14%)
leucine-rich repeat 204..227 CDD:275380 4/22 (18%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 6/27 (22%)
lrrc17XP_004913080.1 leucine-rich repeat 58..77 CDD:275380 5/22 (23%)
leucine-rich repeat 78..101 CDD:275380 6/22 (27%)
LRR <86..>319 CDD:227223 52/241 (22%)
LRR_8 101..159 CDD:338972 19/57 (33%)
leucine-rich repeat 102..125 CDD:275380 10/22 (45%)
leucine-rich repeat 126..149 CDD:275380 5/22 (23%)
leucine-rich repeat 150..211 CDD:275380 9/60 (15%)
leucine-rich repeat 212..259 CDD:275380 8/55 (15%)
leucine-rich repeat 260..283 CDD:275380 4/22 (18%)
LRR_8 262..316 CDD:338972 13/53 (25%)
leucine-rich repeat 284..307 CDD:275380 7/22 (32%)
leucine-rich repeat 308..331 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282791at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.