DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1504 and lrrc4c

DIOPT Version :9

Sequence 1:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_002938986.1 Gene:lrrc4c / 100188921 XenbaseID:XB-GENE-5772259 Length:639 Species:Xenopus tropicalis


Alignment Length:398 Identity:107/398 - (26%)
Similarity:166/398 - (41%) Gaps:80/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLIIALSVVVCLWNSQQTETSKSCPAECICLSQ-TQVLCNTGGLEQIPLRQLPATVENLALTKN 69
            ::|.:.|.||..|..:|      :||:.|.|.:| ::|:|....|.::| ..:......|.|.:|
 Frog    29 VLLALQLLVVAGLVRAQ------TCPSVCSCSNQFSKVICTRRNLREVP-DGISTNTRQLNLHEN 86

  Fly    70 NFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLS 134
            ...|||.|||..||.|:.|.|..|:|..|            |:.            ||.||.||:
 Frog    87 QIQIIKVDSFKHLRHLEVLQLSRNHIRTI------------EIG------------AFNGLANLN 127

  Fly   135 TILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTNVGHLIL--PSGIRSIEQDA 197
            |:.|..|::..|...||...|.:|.:.|.|||:..|.|.||:.:.::..|.|  ...:..|.:.|
 Frog   128 TLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGEMKRLSYISEGA 192

  Fly   198 FFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESD-----LGVICADAFTGLTQVETLQI 257
            |.|:..:..|.|...:|:::...|       .|:.|.|.|     |.|:...:|.|||.::.|.|
 Frog   193 FEGLSNLKYLNLGMCNLRDIPNLT-------PLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWI 250

  Fly   258 LNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHI------ 316
            ::::|..||...|....::..|....|::...|......:..::.:||..|.:.|.|.|      
 Frog   251 MHSQIQVIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHNLQRIQLHHNPWNCNCDILWLSWW 315

  Fly   317 --HTLLDG----------PLAEGAHNLTDFLQKNY--CISP--------LEVNGRVMSELDIDSI 359
              ..:..|          |..:|.|...  |..||  |.:|        |.|...:.:||..   
 Frog   316 LKEIVTTGSTCCARCSTPPSLKGTHIAE--LDHNYFTCYAPVIVEPPADLNVTEGMAAELKC--- 375

  Fly   360 GRCSDQLT 367
             |.|..||
 Frog   376 -RASTSLT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 10/22 (45%)
LRR_5 73..200 CDD:404228 42/128 (33%)
leucine-rich repeat 85..108 CDD:275380 6/22 (27%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 4/22 (18%)
leucine-rich repeat 228..251 CDD:275380 9/27 (33%)
leucine-rich repeat 252..275 CDD:275380 6/22 (27%)
lrrc4cXP_002938986.1 LRRNT 47..78 CDD:214470 9/31 (29%)
LRR <77..302 CDD:227223 71/255 (28%)
leucine-rich repeat 78..101 CDD:275380 10/22 (45%)
leucine-rich repeat 102..125 CDD:275380 11/46 (24%)
leucine-rich repeat 126..149 CDD:275380 7/22 (32%)
leucine-rich repeat 150..173 CDD:275380 9/22 (41%)
leucine-rich repeat 174..198 CDD:275380 6/23 (26%)
leucine-rich repeat 199..220 CDD:275380 5/27 (19%)
leucine-rich repeat 221..244 CDD:275380 8/22 (36%)
leucine-rich repeat 245..268 CDD:275380 6/22 (27%)
leucine-rich repeat 269..290 CDD:275380 3/20 (15%)
LRRCT 301..351 CDD:214507 11/51 (22%)
Ig 354..443 CDD:416386 9/33 (27%)
Ig strand A 354..357 CDD:409353 1/2 (50%)
Ig strand A' 361..364 CDD:409353 0/2 (0%)
Ig strand B 370..377 CDD:409353 2/10 (20%)
Ig strand C 383..388 CDD:409353 107/398 (27%)
Ig strand C' 391..393 CDD:409353
Ig strand D 402..406 CDD:409353
Ig strand E 409..413 CDD:409353
Ig strand F 423..430 CDD:409353
Ig strand G 433..443 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D180608at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.