DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx7 and shakB

DIOPT Version :9

Sequence 1:NP_788872.1 Gene:Inx7 / 33027 FlyBaseID:FBgn0027106 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_608410.2 Gene:shakB / 33062 FlyBaseID:FBgn0085387 Length:532 Species:Drosophila melanogaster


Alignment Length:401 Identity:128/401 - (31%)
Similarity:210/401 - (52%) Gaps:47/401 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYIGEHIQCL-SDGVVSPVINTFCFFT 73
            |..:..::.|.||:.||:||...|.::|:..::.:|:|||:|..|.|: :..:...|:||:|:..
  Fly   167 QVSRSSVSHVKIDSPVFRLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDVLNTYCWIH 231

  Fly    74 PTFTVVRDQNQTAYRPGSEPPGIGAFDPEKD---TIKRHAYYQWVPFVLFFQALCFYIPHALWKS 135
            .|:|||   :....:.|||.|..|..:.:..   |||...|||||.|.|||||:.||.|..||||
  Fly   232 STYTVV---DAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWKS 293

  Fly   136 WEGGRIKALVFGLRMVGLTRYLKNDSLRIGKLNIPSMAEAEERVKDIRRTMIDRMRLNQSWGAHL 200
            ||||:|.||:..|                 .:.|.|.||.:::.|.:...:.:.:|.:..|....
  Fly   294 WEGGKIHALIMDL-----------------DIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYRY 341

  Fly   201 VFAEVLNLINLLLQITWTNRFLGGQFLTLGPHALKNRWSDELSVLD---LVFPKITKCKFHKFGD 262
            ...|:|.|||::.|:...|||..|:|:|.|...:....:|:...:|   .:||::|||.|.|:|.
  Fly   342 YVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGS 406

  Fly   263 SGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVTVLGLLWRILTLCFYRNVTFTRWSLYWAK 327
            ||.::.|||:|::.||::||||||.||||:..|..:|:|.|::|::.:...|    .|..|:..:
  Fly   407 SGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPR----MRVYLFRMR 467

  Fly   328 PGQLDENELLAVIDKCNFSNWMFLFFLRSNLSEFLFKKVIYHLASEFPNPDHDNDVNAYREAPPT 392
            ...:..:.:..::.:....:|..|:.|..|:...:|:.|:..||:...:..|             
  Fly   468 FRLVRRDAIEIIVRRSKMGDWFLLYLLGENIDTVIFRDVVQDLANRLGHNQH------------- 519

  Fly   393 PAKNRYPELSG 403
               :|.|.|.|
  Fly   520 ---HRVPGLKG 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx7NP_788872.1 Innexin 22..374 CDD:279248 120/358 (34%)
shakBNP_608410.2 Innexin 179..514 CDD:279248 120/358 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 1 0.950 - 0 Normalized mean entropy S12312
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
1110.930

Return to query results.
Submit another query.