DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx7 and inx-10

DIOPT Version :9

Sequence 1:NP_788872.1 Gene:Inx7 / 33027 FlyBaseID:FBgn0027106 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001024139.1 Gene:inx-10 / 188580 WormBaseID:WBGene00002132 Length:559 Species:Caenorhabditis elegans


Alignment Length:330 Identity:92/330 - (27%)
Similarity:152/330 - (46%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NIVFKLHYRWTFVILLVATLLITSRQYIGEHIQCLSDGVVS----PVINTFCFFTPTFTVVRDQN 83
            :.|.:||..:|..:|:...:|::.:|:.|:.::||...:.|    .....:|:.:.|:       
 Worm    20 DFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLVPDIFSSSWEQYAENYCWASDTY------- 77

  Fly    84 QTAYRPGSEPPGIGAFDPEKDTIKRHAYYQWVPFVLFFQALCFYIPHALWK---SWEGGRIKALV 145
               |.|.:||  :.....::...::.:|||||||.|..:|.||.:|..|||   ...|.:|..:|
 Worm    78 ---YVPTNEP--VAGLQSDEKRQRKISYYQWVPFFLLLEAACFRLPSLLWKYLAGHSGIKINEIV 137

  Fly   146 FGLRMVGLTRYLKNDSLRIGKLNIPSM-AEAEERVKDIRRTMIDRMR-------LNQSWGAHLVF 202
               ::......:|.|   |.:.||.|: ...:..::..||....::|       .|..:.|..|.
 Worm   138 ---KLSSDPNNIKPD---IKRANIKSLTVHLQGALRFHRRLQKKQIRPHRFLWLFNLPYSAFFVT 196

  Fly   203 AEVL-----NLINLLLQITWTNRFLGGQFLTLGPHALKNRWSDELSVLDL----------VFPKI 252
            |..|     .|.|:.||:.:.||||         ...|.:|....:::||          :||::
 Worm   197 AMYLCTKFFYLANVCLQLMFMNRFL---------ETDKYKWYGMGALVDLLNGTTWEQSGMFPRV 252

  Fly   253 TKCKFHKFGD---SGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVT-------VLGLLWRI 307
            :.|.|    |   .|::|.|...||:.:||.||||:|:|||||..||:.|       :|..|||.
 Worm   253 SLCDF----DVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFTFGSFFYWLLVSLWRH 313

  Fly   308 LTLCF 312
            |.:.|
 Worm   314 LNVRF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx7NP_788872.1 Innexin 22..374 CDD:279248 92/330 (28%)
inx-10NP_001024139.1 Innexin 20..380 CDD:279248 92/330 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.