DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx7 and inx-14

DIOPT Version :9

Sequence 1:NP_788872.1 Gene:Inx7 / 33027 FlyBaseID:FBgn0027106 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_492078.1 Gene:inx-14 / 172488 WormBaseID:WBGene00002136 Length:434 Species:Caenorhabditis elegans


Alignment Length:382 Identity:90/382 - (23%)
Similarity:154/382 - (40%) Gaps:98/382 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FSSVRQYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYIGEHIQCL----SDGVVS-- 63
            |.:.:.|..:|           :||. :|..:|....||..::|:.|..|.|:    .|.:.|  
 Worm    16 FKAAKLYEFYD-----------RLHL-FTVYLLGFFVLLTGAKQHFGNPIDCMLPKQHDDLKSWR 68

  Fly    64 PVINTFCFFTPTFTVVRDQNQTAYRPGSEPPGIGAFDPEKDTIKRHAYYQWVPFVLFFQALCFYI 128
            ..|:.||.|..||........:.:...:|...:.             |||||||...||..||.:
 Worm    69 DYIHNFCLFYGTFRYDVSNGTSEFGSYTEDASVN-------------YYQWVPFFFAFQVCCFLL 120

  Fly   129 PHALWKSWEGGRIKALVFGLRMVGLTRYLKNDSLRIGKLNIPSMAE-AEERVKDIRRTMIDRMRL 192
            |...|     ..::.|:: :.|..:..|       .||:|.....| .:|:|..|...|.|..:.
 Worm   121 PFWCW-----AYMQKLIY-IDMAFIVDY-------SGKINSEKTFEKTKEKVDRIVNYMHDHFKF 172

  Fly   193 NQ-------SW-GAHLVFAEVLN-------LINLLLQI----------TWTNRF-LGGQFLTLGP 231
            .:       || ..:..|..||.       :.|:::|:          :||..| |.|:|:...|
 Worm   173 RRAHKMGYLSWITFNSAFPSVLYSLTKLFFITNVIIQVNLVCKFLDVDSWTWGFDLLGKFIHPTP 237

  Fly   232 HALK-NRWSDELSVLDLV----------FPKITKCKFHKFGDSGSIQMHDALCVMALNIMNEKIY 285
            .|.: :.:||:.....::          ||.:..|::.......:...|.|.|::.:|::||||:
 Worm   238 RAPEFSSFSDKQRFAAILTDGSYNRFQYFPILVGCEYQLQESVSNFVNHKAQCIIPMNVINEKIF 302

  Fly   286 IILWFWYAFLLIVTVLGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDK 342
            |.|:||   ||::|.|.::..:            :|.|. .|..:|:|..:..:|.|
 Worm   303 IGLYFW---LLVLTALSVIGTV------------KWILR-IKSKKLNEVMIYKLIKK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx7NP_788872.1 Innexin 22..374 CDD:279248 87/365 (24%)
inx-14NP_492078.1 Innexin 24..397 CDD:279248 88/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.