Sequence 1: | NP_523419.1 | Gene: | Rab10 / 33025 | FlyBaseID: | FBgn0015789 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017979.1 | Gene: | RAB28 / 9364 | HGNCID: | 9768 | Length: | 221 | Species: | Homo sapiens |
Alignment Length: | 214 | Identity: | 66/214 - (30%) |
---|---|---|---|
Similarity: | 106/214 - (49%) | Gaps: | 12/214 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGK-KIKLQIWDTA 66
Fly 67 GQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKW---LRNIDEHANEDVEKMILGNKCDMTD 128
Fly 129 KRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVI---IDR 190
Fly 191 RNQEKA-----PGYSKCCA 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab10 | NP_523419.1 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 55/169 (33%) |
RAB28 | NP_001017979.1 | Rab28 | 13..221 | CDD:206694 | 65/207 (31%) |
Effector region. /evidence=ECO:0000250 | 41..49 | 3/7 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |