DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and CRACR2A

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_006719084.1 Gene:CRACR2A / 84766 HGNCID:28657 Length:732 Species:Homo sapiens


Alignment Length:197 Identity:70/197 - (35%)
Similarity:117/197 - (59%) Gaps:10/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERF 71
            |.|||::.:|:|.||||..|.||.:|.|:....:|:|||:::||:.:...::.||:||||||||:
Human   544 DRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERY 608

  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136
            ..||..::|.|.|::::||:|:::||.::.:||.:::|...:.|..::||||.|...:|.|.:..
Human   609 RCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKLDNEKEREVPRGL 673

  Fly   137 GEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYSK 201
            ||.:|.|:.:.|.|.||.|..|.:.:...||..:          :.||..:.:...|...|...|
Human   674 GEQLATENNLIFYECSAYSGHNTKESLLHLARFL----------KEQEDTVREDTIQVGHPAKKK 728

  Fly   202 CC 203
            .|
Human   729 SC 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 64/165 (39%)
CRACR2AXP_006719084.1 EFh 54..114 CDD:298682
EF-hand_7 55..109 CDD:290234
RILP-like <226..313 CDD:304877
RAB 547..710 CDD:197555 62/172 (36%)
Rab 547..705 CDD:206640 61/157 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.