DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and AT5G59840

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_200792.1 Gene:AT5G59840 / 836105 AraportID:AT5G59840 Length:216 Species:Arabidopsis thaliana


Alignment Length:207 Identity:117/207 - (56%)
Similarity:157/207 - (75%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTA 66
            |:..||.|.||||||||||||:|:|.||||.:||::||:||||||||:|:||.||:|||||||||
plant     8 ARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTA 72

  Fly    67 GQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTD-KR 130
            |||||.||||:||||||||:||||:|:|.||.||..|:|||::||:::|.|:::|||.||.: ||
plant    73 GQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKR 137

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEK 195
            .|.|.:|:|:|.|:||:|.|||||:|:|:|..|..:|:.|..:.:..:|......:.|.:.:|..
plant   138 AVPKSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAKDIKQRLADTDSRAEPATIKISQTDQAA 202

  Fly   196 APGY----SKCC 203
            ..|.    |.||
plant   203 GAGQATQKSACC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 108/166 (65%)
AT5G59840NP_200792.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 108/166 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 239 1.000 Domainoid score I589
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 250 1.000 Inparanoid score I1031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm3278
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.